SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084498 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084498
Domain Number 1 Region: 580-689
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 490-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000787
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 3 Region: 916-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000286
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 798-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000953
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 879-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000245
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 6 Region: 687-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 838-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000794
Family EGF-type module 0.03
Further Details:      
 
Domain Number 8 Region: 351-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000191
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0084498
Domain Number - Region: 472-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000254
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 767-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00461
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084498   Gene: FBgn0004197   Transcript: FBtr0085128
Sequence length 1407
Comment pep:known chromosome:BDGP5:3R:22997818:23019716:-1 gene:FBgn0004197 transcript:FBtr0085128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKMFRKHFRRKPATSSSLESTIESADSLGMSKKTATKRQRPRHRVPKIATLPSTIRDCR
SLKSACNLIALILILLVHKISAAGNFELEILEISNTNSHLLNGYCCGMPAELRATKTIGC
SPCTTAFRLCLKEYQTTEQGASISTGCSFGNATTKILGGSSFVLSDPGVGAIVLPFTFRW
TKSFTLILQALDMYNTSYPDAERLIEETSYSGVILPSPEWKTLDHIGRNARITYRVRVQC
AVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDR
PGECECRPGWRGPLCNECMVYPGCKHGSCNGSAWKCVCDTNWGGILCDQDLNFCGTHEPC
KHGGTCENTAPDKYRCTCAEGLSGEQCEIVEHPCATRPCRNGGTCTLKTSNRTQAQVYRT
SHGRSNMGRPVRRSSSMRSLDHLRPEGQALNGSSSPGLVSLGSLQLQQQLAPDFTCDCAA
GWTGPTCEINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGI
AANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKE
GWGGVTCAENLDDCVGQCRNGATCIDLVNDYRCACASGFKGRDCETDIDECATSPCRNGG
ECVDMVGKFNCICPLGYSGSLCEEAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAGKHCE
QLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDV
GTFCKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDFTCECMSGWTGKRCSERATGC
YAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTCESGAGWF
RCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEILLSDPKS
ACQNASNTISPYTALNRSQNWLDIALTGRTEDDENCNACVCENGTSRCTNLWCGLPNCYK
VDPLSKSSNLSGVCKQHEVCVPALSETCLSSPCNVRGDCRALEPSRRVAPPRLPAKSSCW
PNQAVVNENCARLTILLALERVGKGASVEGLCSLVRVLLAAQLIKKPASTFGQDPGMLMV
LCDLKTGTNDTVELTVSSSKLNDPQLPVAVGLLGELLSFRQLNGIQRRKELELQHAKLAA
LTSIVEVKLETARVADGSGHSLLIGVLCGVFIVLVGFSVFISLYWKQRLAYRTSSGMNLT
PSLDALRHEEEKSNNLQNEENLRRYTNPLKGSTSSLRAATGMELSLNPAPELAASAASSS
ALHRSQPLFPPCDFERELDSSTGLKQAHKRSSQILLHKTQNSDMRKNTVGSLDSPRKDFG
KRSINCKSMPPSSGDEGSDVLATTVMV
Download sequence
Identical sequences A0A0B4LIS1
FBpp0084498 FBpp0084498 NP_001287558.1.81976 NP_524527.3.81976 7227.FBpp0084498 FBpp0084498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]