SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084973 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084973
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.31e-20
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084973   Gene: FBgn0039730   Transcript: FBtr0085608
Sequence length 384
Comment pep:known chromosome:BDGP5:3R:25819196:25820931:-1 gene:FBgn0039730 transcript:FBtr0085608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTTAKVFVGSLPRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGT
IFKGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFR
EEVGGRFSNEGPRSSNSSAAKFGPVRNESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFA
GGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSGYRGGGNNSDFQGGSSSSG
GGGSVNQRAGGGGPGPSHVRQDRRGFALPVEHQQQQMGFGRFGNGPMNSGNRGTNGGNPP
GGRGFFNGGGGGFNDRRDSSHETSSPQGGPSKRGGSGGRNHNQNGINAYHSEFPPLGSGG
GGPGQRNRFNGPRPGPNMGGNRRF
Download sequence
Identical sequences Q9VAC9
7227.FBpp0084973 FBpp0084973 NP_651755.2.81976 FBpp0084973 FBpp0084973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]