SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085887 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085887
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-31
Family Galectin (animal S-lectin) 0.00085
Further Details:      
 
Domain Number 2 Region: 160-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-26
Family Galectin (animal S-lectin) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085887   Gene: FBgn0034365   Transcript: FBtr0086708
Sequence length 321
Comment pep:known chromosome:BDGP5:2R:14509050:14510475:1 gene:FBgn0034365 transcript:FBtr0086708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTEFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRND
VIVRNSRINGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRY
RMPLGTIRALEIRDQIQVIKQVDHRTVFPNPWPAVHASDYFKAFSNDQPILFSPGHVIVL
TARCFENKKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERHGGFPFV
FNQQFKLALAFTEREVLTAVDGYNFFSYTWRTPNAMMNLVGFKVTSINGLVVQITGVDHL
QTGDPTCAGFEKYSRHDYECV
Download sequence
Identical sequences A1ZBB1
FBpp0085887 FBpp0085887 FBpp0085887 NP_611349.2.81976 7227.FBpp0085887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]