SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086264 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086264
Domain Number 1 Region: 1184-1478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.76e-80
Family Protein kinases, catalytic subunit 0.000000695
Further Details:      
 
Domain Number 2 Region: 501-689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.57e-27
Family MAM domain 0.0096
Further Details:      
 
Domain Number 3 Region: 285-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000427
Family MAM domain 0.0026
Further Details:      
 
Weak hits

Sequence:  FBpp0086264
Domain Number - Region: 457-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00126
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number - Region: 1055-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086264   Gene: FBgn0040505   Transcript: FBtr0087118
Sequence length 1701
Comment pep:known chromosome:BDGP5:2R:12513590:12525279:-1 gene:FBgn0040505 transcript:FBtr0087118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLRQLVVVLAILSLLVDPSFAQRPLIMNHTFSSLPMSQHPSFNSWPSASGGKQLRNGR
LHEQPLPLPQPTLPVATQYEDYEAAPPGSRRDNKRRLAQMAQRPGSGNGGRRGMESLRKE
LMNPSVGGPGGGISGGGSGYPSYSATSSIGRIDGLGQGLGSADRYGALYDQLRQPSGMAA
MTAGPLGGPYSTRFPPLYAGVDDQPKRSNRKNSISELYKLKKALNQADEPAGGVTHGNFE
GDPQPSSADPLQEIKDRIRDTSPNANTYAPHTDATPSSEYEYELGVKCNFETPCSWTWGN
YSDGFQVITGTELSKRNLTGLLPGPAADSIDDANGHFLYARVNPSSRPLNLTSPEFSTTM
EKCFLEVYMHQSDMSHGLSRVVVELLHTAESSWVPAEILGDNVRQWTRKVYRLGRVSRDF
RIVFEVVPDLRVGQKGHVALDNLRMVNCFPEGTKSEKCSTSQVKCTSSKVPVCIHLPRIC
DITRDCDEAEDEQQSCDKIPYGGRCDFEEDWCGWRDSGKTTLTWSRHTGSSPTHDTGPDG
DHTMQHLQNNTSGYYMLVNMNQHMNNSEKNSIIGFASNAIMVSKTFNPPPSVHGNPDSPY
RNSCVVRFFIHQFGKNPGSINLSVVEMKEKENITTTLWWSTKNQGSDWMRAEYVLPNITS
KYYLQFEARMGMRIYSDVAVDDFSLSPECFGLNIPEDHLGGYNYWDVRQNLKSPTYKDFE
YTNYLELTTCDTRGMIGPSQAQCEAAYREQNKTHVLREVHVVEDQSSYKGMQKWKVPHEG
HYTIIAKGASGGLGSGGVGSSRGSVAVAILELHKNEELYFLVGQQGENACIKSMGVLKEA
GCGTDHDLDLAQYSFRSKQDMVKNIYIENGAGGGGGGSYVFLLNQAKNEAVPLLVAGGGG
GLGIGQYIDEDFQHGQKAKPLQAPESGQINGEPLNKKTAGPGGGWRAKEDQALSPTYGAA
LLQGGRGGHSCYVELADNGTSVHRHGQGGFGGGGGGCNTGGGGGGYAGGDVYLTESNGEG
GSSYISPSRSLREISEIHAGASSGPGAIIIIPAIEGCGCDYRCVALDEFRSKVRCICPDG
WSLKRDNHTACEIREEAGKSSFQYLVSILMISLAVLFICIAALIFMLYNRYQRKKQSKKR
HKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNSLPQVARDSLQLVNALG
KGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLI
GVCFDRQPYYIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESK
RFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLD
GIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMA
DCWNPTPEDRPTFITLLEHLTACTQDASIMNAPLPNILGPTASERDDTVIRPPNGEEFCL
AVPDYLVPLPPGGSNNPSMASGSGYVPELQRQQMSSCTPPAVTSPAAPHPRPVENIAPTS
GDCWETSFILPNSKVEPPVVGSGHDVPLAGGEEAKLISLDTPQPTPTTIQPPLSFASQLD
GITLDPSALTKSLPNGNAKQSYANVQVKNEAEAKVINGVVGNGTVMNGDVSTGSGGADSP
FTIQGYAERYKDNNNHSEISC
Download sequence
Identical sequences Q7KJ08
FBpp0086264 FBpp0304259 7227.FBpp0086264 FBpp0086264 FBpp0086264 NP_001261027.1.81976 NP_652600.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]