SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086476 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086476
Domain Number 1 Region: 272-361
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000231
Family Canonical RBD 0.00064
Further Details:      
 
Domain Number 2 Region: 376-472
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000462
Family Canonical RBD 0.0009
Further Details:      
 
Domain Number 3 Region: 535-638
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000489
Family Canonical RBD 0.0026
Further Details:      
 
Weak hits

Sequence:  FBpp0086476
Domain Number - Region: 842-914
Classification Level Classification E-value
Superfamily ApbE-like 0.0173
Family DVU1097-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086476   Gene: FBgn0023441   Transcript: FBtr0087343
Sequence length 967
Comment pep:known chromosome:BDGP5:2R:11547521:11564198:-1 gene:FBgn0023441 transcript:FBtr0087343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPEHVVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIK
DRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGK
PLSEAIEEFDAYLRSLSLHDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRK
EFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDM
VTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFR
GLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHIGTRYIEVYRASGEDFL
AIAGGASNEAQAFLSKGAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFV
KKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVLNRSMDPKNY
ESGGGHSQPPLIAQLPTMQLPLLPQVGAHSLSHSLGASPANLCPPVPPPALPLPTQHLIT
SGTTKNCIRLRGLPYEAMVEHILHFLDDFAKHIIYQGVHMVINAQGQPSGEAFIQMDLEE
SARLCAQRRHNHYMMFGKKYRYIEVFQCSGDDMNMVLNGGLASPVAQPPPPHLGHAHKQQ
SLLAATTGMFSSAGQSPTTVAAGTAQSPLGGTHTHTHPHSHAHAHATGHAHAAAAAAHHG
LSASSAMLPGLSAAASASGLASFMSAGQQSAAAAAHSAASLQNAAVALAPQGYALNPFSL
PPPGSAAAAAASTPALLAQQQAQFIAQQSLLVRQQAAAAALAAEQQQQQQQQQQLYASAM
LQQHPLYLQQQQQQQQLYASAMLQQGQPQFVLMQRPSAAYLPPFPLSYMSAAGAASGVGV
APGAAVAGAAAAASPSASNSSLSQSMKRSYENAFQQEAAGAAAAASAAKRALTRQPSSVY
SYYNSGI
Download sequence
Identical sequences E2QCE8 Q9BJZ5
NP_524691.1.81976 NP_725481.1.81976 NP_725482.1.81976 FBpp0086476 FBpp0086477 FBpp0086479 FBpp0086476 FBpp0086477 FBpp0086479 7227.FBpp0086477 FBpp0086476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]