SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086569 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086569
Domain Number 1 Region: 20-85
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.94e-20
Family SCOPe 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086569   Gene: FBgn0050476   Transcript: FBtr0087439
Sequence length 106
Comment pep:known chromosome:BDGP5:2R:10640031:10640774:1 gene:FBgn0050476 transcript:FBtr0087439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFAQHDITGRALL
RITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDMERLNIY
Download sequence
Identical sequences A0A1B2AIY1 B3NQT3 B4QFY1 Q8ML92
NP_725413.1.81976 XP_001975593.1.56816 XP_002081541.1.80810 FBpp0086569 FBpp0139024 FBpp0086569 3bs5_A 7227.FBpp0086569 FBpp0086569 FBpp0209476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]