SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086647 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086647
Domain Number 1 Region: 582-1197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-133
Family Tandem AAA-ATPase domain 0.061
Further Details:      
 
Domain Number 2 Region: 277-361
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000157
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086647   Gene: FBgn0086895   Transcript: FBtr0087518
Sequence length 1242
Comment pep:known chromosome:BDGP5:2R:10040661:10044611:1 gene:FBgn0086895 transcript:FBtr0087518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRTYDTFRKALLDNGAEFP
DSLVQNLQRIINLMRPSRPGGASQEKTVGDKKEDKKSQLLKMFPGLALPNDTYSKKEESD
DDEKVKAKPEKHSETHKKTDMSDVDAAMMELEALAPGEGATLVRPHKEVSSRDRHKRRSR
DRDTKRRSRSREDRHSDRRRSRSRDKERRRRSRSRDNRRRSRSREDRDRDRDRRHKSSSS
RDHHERRRRSRSRSTERRDRRDRSRDCSEKMPPPSAAMTDDPEAGKIYSGKIANIVPFGC
FVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITGQKVSLSMKEVDQ
DSGKDLNPLSHAPEDDESLRDRNPDGPFSSSTSMLNLQGNGMEGDEHESRKRVTRISSPE
RWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGHGRALHDL
SPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPTSLNKNWIDPLPEDESR
SLAANMRGMAAAPPEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPIYKLRDDLIKAVT
DNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLG
QEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFG
LLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDA
SLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSE
MQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPI
SQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGIND
LLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVAL
QCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSN
AWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKD
PQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPS
FFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
Download sequence
Identical sequences A1Z9L3
7227.FBpp0086647 NP_610928.1.81976 FBpp0086647 FBpp0086647 FBpp0086647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]