SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086768 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086768
Domain Number 1 Region: 63-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 2 Region: 113-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 196-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000876
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 4 Region: 33-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086768   Gene: FBgn0033880   Transcript: FBtr0087642
Sequence length 319
Comment pep:known chromosome:BDGP5:2R:9742083:9743270:-1 gene:FBgn0033880 transcript:FBtr0087642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGAHQNLSIQLVIFLSLAVTICLGSQNATSCGHRCGGGDCIQLDQLCDGSANCLDGSDE
TVAMCEKVWCPGYAFRCSYGACIASTAVCDGVQDCVDGSDEQGWLCRAQMQQANCDNWEM
YCSSGQCMTYSKLCDGIRDCRDGDDELESLCEGVTIPTTTVSSTTSTTTESSIHRITPTV
PVTRKASRPNPLQENGECVVPQLPNVMVKHFTDAILTVGSRVANGTRIYYDCPAEHRLKG
ENQNICQDALWARKFPYCETPQAYVFSLVIVIFCFLIVVLVFLIWRVRRENGSRRQREEH
IWLVETSSNLPQTSSIPKV
Download sequence
Identical sequences Q4V6B0
NP_610911.1.81976 FBpp0086768 7227.FBpp0086768 FBpp0086768 FBpp0086768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]