SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088181 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088181
Domain Number 1 Region: 10-106,135-161
Classification Level Classification E-value
Superfamily SH2 domain 5.27e-27
Family SH2 domain 0.000095
Further Details:      
 
Domain Number 2 Region: 201-265
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000063
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088181   Gene: FBgn0024811   Transcript: FBtr0089112
Sequence length 271
Comment pep:known chromosome:BDGP5:4:230882:233791:1 gene:FBgn0024811 transcript:FBtr0089112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTFDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNY
IINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGS
DQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSI
SGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWE
GELNGKNGHFPFTHVEFVDDCDLSKNSTEIC
Download sequence
Identical sequences Q9XYM0
7227.FBpp0088181 FBpp0088181 FBpp0088182 FBpp0088181 FBpp0088182 NP_651908.1.81976 NP_726549.1.81976 FBpp0088181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]