SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088184 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088184
Domain Number 1 Region: 147-283,312-410
Classification Level Classification E-value
Superfamily NHL repeat 0.000022
Family NHL repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088184   Gene: FBgn0039896   Transcript: FBtr0089115
Sequence length 463
Comment pep:known chromosome:BDGP5:4:248550:251054:1 gene:FBgn0039896 transcript:FBtr0089115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSMTIFNIITQLVFLSKTLNGNLSVQPVFQTLDGYEYTSQSFSQNLQSESQLEIVYEWK
YLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNGVPASLGTLPFPP
KESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAVDRCDRIWLIDSGIVNATINLNQICP
PKIVVYDLKSDELIVRYNLEASHVKQDSLHSNIVVDIGEDCDDAHAIVSDVWRFGLLVYS
LSKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSIYYNKKIMERVLYFHPMASF
KEFMVPMNILLNESVWQTNTQEYAKYFIPIGDRGYNSQSSTSGVTRNGIMFFTQVHQDDI
GCWDTSKPYTRAHLGKFHNMENSNLIQFPNDLKVDKEKDQNVWLISNRLPIFLYSNLDYG
EVNFRILKANVNKIIRNSVCNPDNSYINTSKSAFVLIEEGQCF
Download sequence
Identical sequences Q9V4C0
FBpp0088184 FBpp0088184 NP_651912.3.81976 FBpp0088184 7227.FBpp0088184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]