SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088211 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088211
Domain Number 1 Region: 651-796
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000518
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 284-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000209
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 505-651
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000691
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 189-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0088211
Domain Number - Region: 247-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000167
Family EGF-type module 0.0055
Further Details:      
 
Domain Number - Region: 424-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0035
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088211   Gene: FBgn0051999   Transcript: FBtr0089144
Sequence length 917
Comment pep:known chromosome:BDGP5:4:235635:246581:-1 gene:FBgn0051999 transcript:FBtr0089144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYKLCAFMCFLIVGGHVTTTMASDSISGYIRKCCINGLRHARTTASCKKIDIAPTIIPQ
LWLGLCHSTLEVCCSRELDHQDCELGRLAALDGTRCDGEGNVTSSSYATCCRSCQIGLAV
KASKANCKDPLFSFIFLIESYRACCYGSADFKDQPGIDEIDKANSITDEGELPFVSEEDM
NVTIVLTGDDDICGKIENLCAHICENTFDAYQCKCHPGFMLDNNNVTCSPMKTQICPSGY
NLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPGFHYDHDYDACKD
DYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCL
PGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCD
DDDECTLSTHNCPSNYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRY
PYPLAVHPEYSQNNDSISTNRRVDCSPGFYRNTLGACIDTNECMEQNPCGNHERCINTNG
HFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELK
RSIGGASTCVDTNECALEQRVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDE
CQVIPGLCQQKCLNFWGGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLCMGLCINTPG
SYQCSCPRGYILAADMNTCRDVDECATDSINQVCTGRNDICTNIRGSYKCTTVNCPLGYS
IDPEQKNRCRQNLNFCEGEECYTQPSAFTYNFITFVSKLMIPPDGRTIFTLRGPLWYDNI
EFDLKIVRIQATTNIQKATDGSFDTLQNNNQVNVILKKSLEGPQDIELELSMTVYTNGMP
RGKSVAKLFLFVSQHTF
Download sequence
Identical sequences Q9V4B8
7227.FBpp0088211 FBpp0088211 FBpp0088211 FBpp0088211 NP_001284712.1.81976 NP_726551.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]