SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088487 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088487
Domain Number 1 Region: 337-589
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.46e-86
Family STAT DNA-binding domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 591-720
Classification Level Classification E-value
Superfamily SH2 domain 4.2e-25
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 3 Region: 191-342
Classification Level Classification E-value
Superfamily STAT 1.06e-22
Family STAT 0.0073
Further Details:      
 
Weak hits

Sequence:  FBpp0088487
Domain Number - Region: 1-42
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 0.00248
Family Transcription factor STAT-4 N-domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088487   Gene: FBgn0016917   Transcript: FBtr0089484
Sequence length 761
Comment pep:known chromosome:BDGP5:3R:16361405:16376852:-1 gene:FBgn0016917 transcript:FBtr0089484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWKRISSHVDCEQRMAAYYEEKGMLELRLCLAPWIEDRIMSEQITPNTTDQLERVALK
FNEDLQQKLLSTRTASDQALKFRVVELCALIQRISAVELYTHLRSGLQKELQLVTEKSVA
ATAGQSMPLNPYNMNNTPMVTGYMVDPSDLLAVSNSCNPPVVQGIGPIHNVQNTGIASPA
LGMVTPKVELYEVQHQIMQSLNEFGNCANALKLLAQNYSYMLNSTSSPNAEAAYRSLIDE
KAAIVLTMRRSFMYYESLHEMVIHELKNWRHQQAQAGNGAPFNEGSLDDIQRCFEMLESF
IAHMLAAVKELMRVRLVTEEPELTHLLEQVQNAQKNLVCSAFIVDKQPPQVMKTNTRFAA
SVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTME
YQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDFQIRVWTLSLPV
VVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDRVTWAQLSVALNIKFGSCTGRSLTID
NLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFFAIMKLTKDHMLGMWKAGCIM
GFINKTKAQTDLLRSVYGIGTFLLRFSDSELGGVTIAYVNENGLVTMLAPWTARDFQVLN
LADRIRDLDVLCWLHPSDRNASPVKRDVAFGEFYSKRQEPEPLVLDPVTGYVKSTLHVHV
CRNGENGSTSGTPHHAQESMQLGNGDFGMADFDTITNFENF
Download sequence
Identical sequences A0A0B4KHS7 Q24151
NP_001262762.1.81976 NP_996243.1.81976 FBpp0088489 FBpp0088489 7227.FBpp0088489 FBpp0088487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]