SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088497 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088497
Domain Number 1 Region: 109-403
Classification Level Classification E-value
Superfamily NHL repeat 2.62e-24
Family NHL repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088497   Gene: FBgn0262728   Transcript: FBtr0089500
Sequence length 406
Comment pep:known chromosome:BDGP5:2R:19575681:19578107:1 gene:FBgn0262728 transcript:FBtr0089500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLLFVALLAISLGYVASSSSNHLPAGLAMDLGPGVNLNERFFDQVRALIKRRLQEKGL
AKPEQPELAMPLTDDDAVALQNQRSYDNVPLPAASVPTPVLVENWPTEQHSFGQVTAVAV
DPQGSPVVFHRAERYWDVNTFNESNIYYLIEYGPIKENTIYVLDAKTGAIKSGWGSNMFY
MPHGLTIDLHGNYWITDVAMHQAFKFKPFSNKPLLTIGKRFRPGSSVKHLCKPTSIAVAT
TGEFFIADGYCNSRILKFNAAGKLLRTIPQPPEFLSLQVPHAITLLEHLDLLCIADRENM
RVVCPKAGLISSHGEGEPAATIQEPDLGRVFGVASFGDIVFAVNGPTSMLPVRGFTIDPR
SETIIGHWGEFKNPHSMAVSVNGSALYVTEIGTNHQTNRVWKYVLA
Download sequence
Identical sequences A0A0B4LG96 Q9W1L5
NP_001286776.1.81976 NP_525118.2.81976 NP_995929.2.81976 FBpp0088497 FBpp0290724 FBpp0088497 7227.FBpp0088497 FBpp0088497 FBpp0290724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]