SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088578 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088578
Domain Number 1 Region: 335-423,503-565
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.89e-31
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 2 Region: 208-319
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-19
Family Canonical RBD 0.0000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088578   Gene: FBgn0031883   Transcript: FBtr0089635
Sequence length 594
Comment pep:known chromosome:BDGP5:2L:7032726:7037620:1 gene:FBgn0031883 transcript:FBtr0089635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDFDVEAMLEAPYMKNNVSAGSGGSGGRKRSGSSPGGGGGHDDDYAENGPRNGSGGGS
SHKKQSKRSRSRSGSRDGKSRRDRGNERSSHRDKDKERDRNRDGGDRDRHRREGGDRDRE
RERERERDRSRRSRSRDERGGGGRYGDRDKDRRSRDRRGGSKSLQVDRSRDKRRRSRSRD
QQRKRLSPIRERKRSHSRSRDRNSRRRGTNSPRRRSPPNGADRTTPTELSPEERDARTVF
CIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQ
RLLGVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFEPFGK
IDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVGNVTERLDMNTT
SLDTDEMDRTGIDLGATGRLQLMFKLAEGAGLAVPQAAANALLATAPQPAPLQQQEVAPS
IATQCFILSNMFDPRTETNPTWDVEIRDDVLEECAKHGGVLHIHVDTISHTGTVYVKCPS
TTTAVLAVNALHGRWFAGRVITAAYVPVINYHTMFPDSINAVDLVTSTRKNTDD
Download sequence
Identical sequences Q9VM49
FBpp0088579 FBpp0088583 7227.FBpp0088583 NP_609095.1.81976 NP_723243.1.81976 FBpp0088579 FBpp0088583 FBpp0088578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]