SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088727 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088727
Domain Number 1 Region: 767-896
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 935-975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000822
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 736-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000015
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 889-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000339
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0088727
Domain Number - Region: 697-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000477
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088727   Gene: FBgn0051665   Transcript: FBtr0089786
Sequence length 1157
Comment pep:known chromosome:BDGP5:2L:1836630:1858550:1 gene:FBgn0051665 transcript:FBtr0089786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKIYVLTLVIAVVAATTSETITNDLTAKSNRTLLKTSTEESREISALGGSTSTATPTTT
ATTSTTTTRATTVAEDEMEETSTPTPTTVRLMTTTQKMVQANLGEIGSIKDALHRIKLSE
KPVDGATTTTEQPEAMDQDEQDEQDVTPTISPLQIQMQAAASYQVAETLADLNEEERARY
DAMLAQQPTASKLNIVDLYPLKIEDIQPIIRNDNDELIKQRTVFTQHENAEEYKQNLMPN
EVEMMVDKEVIEMKDKIQINQEKFGSSTTVKPTTSRPHQGTTADFTGKLLADQDDLITEI
ESKFQLHETTTLRPRVTTVQHPGNTFIDRRVKKSFEFPMQHRASDVMAMPHIDFANTKFQ
TDADAPNPPASHPEFSTTKFYNSKELYNEMLLHNKRKLMKAAKAEGSPIKSAEDTTRATS
SNVTPEGKTFGPTTTTAAGSTATTTAESTTTAATTTRLPATTTGKYQKELKRAKLLLKAL
TPPKSVDKSTASPSSTTSTSTSTTTTMATLLATARTRPSAANPTKTASKPIARPRILSRL
QEKINSLECEIPNVPQDSHLWRGNETHELLLPIVTTEHCKPDEHCVPNVLTWRGEAEIQS
GDILIVEINDAMLNPSHEPNNTSSAVHATQVYQVTRSGHEHCDVTEGVLLDITPLVVDGR
KLVTLYDKDLTEGVNLLIVVSELWGAQCVRLKVTTKTDNCGENADCSGKGVCYSNSGMEE
YECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYES
DPCNPAECMNGGSCVGNSTHFRCDCAPGFTGPLCQHSLNECESSPCVHGICVDQEDGFRC
FCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKP
CPEGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYFQQCNVNPCTHGGTCWSSGDSFYCAC
RPGYTGTMCEDEFVVETVVSSSEFIVDDANARNFNDKTFGSSVVLKSPIELHNAYFAAGV
LAAAIFIVAVVVTICHCKVNQTYRKFSTRSTSFIPILGFSRRPKVQGKLNKHWLSGKGAT
ATSSTNIVAPPGGPRAGGAAGPQQVTRHLPGQPQTQTTLGGQLQERPFLRHLAMNLENDM
YYTVDFSENSQHSPLIQ
Download sequence
Identical sequences Q7KU08
7227.FBpp0088727 FBpp0088727 NP_995611.2.81976 FBpp0088727 FBpp0088727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]