SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0100043 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0100043
Domain Number 1 Region: 302-440
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.53e-28
Family Canonical RBD 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0100043   Gene: FBgn0004227   Transcript: FBtr0100586
Sequence length 742
Comment pep:known chromosome:BDGP5:X:16255566:16262561:1 gene:FBgn0004227 transcript:FBtr0100586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAGKQDNNATQQLPQRQQRGNQQANKNLGKHNAQKQNDSADGGPAEKKQRFGGPNAQN
QNQNQNQNGGVTGGGGAVGGPNQNKNFGNNKGGFVGNRNRNNNRAGNQNRTFPGNNNPNQ
KPNNETSKADGPNALAKNNEPATAAAGQNQANQNANKGQNQRQGQNQNQNQVHGQGNQGG
PGNQGGAGNQGGQGNQGGAGNQGNGQGFRGRNAGNNQGGGFSGGPQNQQRDNRNRSGPRP
GGGAGGAMNSTNMGGGGGGGGGGGPRGGEDFFITQRLRSISGPTFELEPVEVPTETKFSG
RNRLYVGNLTNDITDDELREMFKPYGEISEIFSNLDKNFTFLKVDYHPNAEKAKRALDGS
MRKGRQLRVRFAPNATILRVSNLTPFVSNELLYKSFEIFGPIERASITVDDRGKHMGEGI
VEFAKKSSASACLRMCNEKCFFLTASLRPCLVDPMEVNDDTDGLPEKAFNKKMPDFNQER
SIGPRFADPNSFEHEYGSRWKQLHNLFKTKQDALKRELKMEEDKLEAQMEYARYEQETEL
LRQELRKREVDNERKKLEWEMREKQAEEMRKREEETMRRHQTEMQSHMNRQEEDMLRRQQ
ETLFMKAQQLNSLLDQQEGFGGGGGGNNSTFDNFAGNSNSPFEVFRGNNNNNSTMIGNNA
APNTQEIKRLDGPINEITSNFSPPDLDSDIILVAFVLEEFSSHVFYTKIVQKCESFKKRT
QLNARSNIIKKCISNLNWLIVL
Download sequence
Identical sequences Q8IR16
FBpp0074012 7227.FBpp0074012 NP_727962.1.81976 FBpp0100043 FBpp0074012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]