SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111363 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111363
Domain Number 1 Region: 7-99
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000364
Family Glycosyl hydrolases family 16 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111363   Gene: FBgn0085283   Transcript: FBtr0112448
Sequence length 105
Comment pep:known chromosome:BDGP5:3L:18673509:18673879:1 gene:FBgn0085283 transcript:FBtr0112448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTDFTTIIWQTDKIIFKFDGEFFGAVNNPTLLEPFRKHECHLVLGLTAGGNVNFNDDIL
EMKHKPFLNTHPKTDKQFEELSRNSDWTPLVVDHIRVFAIDKEGK
Download sequence
Identical sequences A8JNV3
7227.FBpp0111363 FBpp0111363 FBpp0111363 FBpp0111363 NP_001097637.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]