SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0111448 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111448
Domain Number 1 Region: 533-635
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.84e-22
Family Canonical RBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111448   Gene: FBgn0085363   Transcript: FBtr0112536
Sequence length 708
Comment pep:known chromosome:BDGP5:X:22274648:22277203:1 gene:FBgn0085363 transcript:FBtr0112536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKVSGTKAKDDGEPATKRERKEMHSHKKDRRERLERMERMDRRDRRDRRERRDRKDRKD
RKDRKEPARGPSSRMRNISPIHSNASESTEADCSDSSYSDSSYSTSGSSSCTSFLSSTSS
SYSSSDSEPEPEGSVKKFERTKHSCCHYRHHRRHRRHQNPRHSHRRRHVTRCHHSNHGRF
SKRLAKKSRRGISAAKGAITVKEEVVEKISPASAPGVIQIPAPIPLPVPAPIPAVLSVSE
AQPRSHSRSQSHSHLHSHSSSHNNPHPQPVPAPVPVPIPAPIAMPTPMREPSSVVLDRKS
RRRSSTSQNIASAASSSIGTNQAIIQSSTITITKTIANATGMAETNSSGGASISSTKNKG
DSSTGQSSKTVVTNNAGSKAGYQAPKTSVASTSSKAVVRSNASASSGHGNHTSSSSSFTQ
LHSSARPSTAKDHDKSPQQNRSGSSGPKGKSSKINDPPRRGSSPSAGAEPTRQKQSVQNQ
NGRNCSSQWNHRRGEGDGEGAEASGRGYRAVGEVNKVAYRNGKDAFKFRQPVRNVRLHIK
GLTRQVTKEHITEIFGHFGALTAVDFPMDRFQGRQGRGYAFVEYSRPEDCASAIKHMNGG
QIDGKLIRVSAFQESMLKAPWRQYRRYSPVNRRQSQRTLSRSGSSSRSRSPSRSASGSEY
GSRSSHSRVRSMSGSRYSRRNRSQSCSYTRSSPRYGHYHRPRRDSRSP
Download sequence
Identical sequences Q0IGP7
7227.FBpp0111448 FBpp0111448 FBpp0111448 FBpp0111448 NP_001097042.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]