SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112240 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0112240
Domain Number - Region: 2-53
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00418
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112240   Gene: FBgn0040587   Transcript: FBtr0113328
Sequence length 63
Comment pep:known chromosome:BDGP5:3R:18552691:18558084:1 gene:FBgn0040587 transcript:FBtr0113328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQQYQQQQQQQQQGNLVGYNNKMNVLPNYTLSGMSSFDAESLPDYSEFDSESVTLDYYK
ERC
Download sequence
Identical sequences Q9VCV2
FBpp0112240 7227.FBpp0112240 FBpp0112240 FBpp0112240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]