SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0112339 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112339
Domain Number 1 Region: 107-201
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-25
Family Canonical RBD 0.0000262
Further Details:      
 
Domain Number 2 Region: 9-110
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.07e-24
Family Canonical RBD 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112339   Gene: FBgn0260943   Transcript: FBtr0113427
Sequence length 499
Comment pep:known chromosome:BDGP5:3L:17069868:17231310:-1 gene:FBgn0260943 transcript:FBtr0113427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKIEQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMV
MKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKI
FVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHF
HEINNKMVECKKAQPKEVMLPANLAKTRAAGRSAYGELVVWGSSHAHSTAATSAAAAGLL
PSSLAAAASVLQQQQQQQQQQQQQQQQQQQHHQQLHHTHPQSPAHSHAHHPHTHSHSQLL
GSLRYTPYPLPAHLSAAAVVVAQQQHHHQQQQQQQQQQQQQQVVAAQQQHQQQQSLAQVV
AAAAGAAPGLLPLANPAPPATPSLLQFAAGQSNAALANSLYADAAAVVGYKRLLAAAAVS
SGLRAPTTALGALQAAAANVPAAAAAAQLQQAQLRQNAALAAAHYPLSELLAMQGGMEMG
AGANSAAAAAASLYQLPGI
Download sequence
Identical sequences FBpp0112339 FBpp0112339 7227.FBpp0112339 NP_001097631.1.81976 FBpp0112339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]