SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112403 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112403
Domain Number 1 Region: 73-163
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.32e-19
Family Canonical RBD 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112403   Gene: FBgn0020660   Transcript: FBtr0113680
Sequence length 459
Comment pep:known chromosome:BDGP5:2RHet:2901752:2917318:1 gene:FBgn0020660 transcript:FBtr0113680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGKKGKKNKGTVISLQSFLCNSDAPVGTTQVSKKIRNLDGDDSDDGSGTLPLVYQLP
TAPRANRIFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRS
RGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNR
DSGNWRRDSQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTR
REVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDE
FNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQDKGRREQGLNEKLAELQVDK
NDNESLSATVSWRTNQDYKESDKINKCPGEKQRDEEIHRLNHARGQFNRPELLREKPNAN
GESKRDCRNDRSVSKKTSQNDLVLQSSNKYSGLDNEGSE
Download sequence
Identical sequences Q7PLL3
FBpp0112403 FBpp0112403 FBpp0112403 NP_001015319.1.81976 7227.FBpp0112403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]