SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112966 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112966
Domain Number 1 Region: 59-310
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.57e-58
Family LplA-like 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112966   Gene: FBgn0034089   Transcript: FBtr0114474
Sequence length 396
Comment pep:known chromosome:BDGP5:2R:12083891:12084445:1 gene:FBgn0034089 transcript:FBtr0114474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLLRRNSSQLRLLLSSAAQATRLASSGVEPPSAGQQEIKKQRRQPPPVVPDSEIKKSV
FISQSSDVFTNLALEDWLYKNFDFSRHHVLLLWANDPCVVIGRHQNPFTEANVSQLVERG
ITLARRNSGGGAVYHDLGNLNCTFFSPRERYDRKYNLNIVTRALFREWAIKAEINERDDI
VVMNKKISGTAAKLGHPNSYHHCTILASANKLHLGESLVREPANYISKATASVPSPIRNL
VDVNRTVNVAQLRSAVGYEYLRTAATTLEDGGSTQTMQQRGFQLVNPTEKWFPGIEELRS
NYSSWDWVIGKTPKFTVQKELEVKGDEQDMKLKLSVEVEAGLMKEIGIQLPQSDQLVPVV
TPLQGKPYNEENLNGILGALKLVSASNVKQAINGSA
Download sequence
Identical sequences Q8SX78
FBpp0112964 FBpp0292865 FBpp0112964 FBpp0292865 NP_001188958.1.81976 NP_611097.2.81976 FBpp0112966 7227.FBpp0112964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]