SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288423 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288423
Domain Number 1 Region: 1081-1354
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.89e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000801
Further Details:      
 
Domain Number 2 Region: 607-752
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-21
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 3 Region: 363-526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000812
Family Fibronectin type III 0.0079
Further Details:      
 
Weak hits

Sequence:  FBpp0288423
Domain Number - Region: 775-871
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000132
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 72-203
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000994
Family Fibronectin type III 0.0076
Further Details:      
 
Domain Number - Region: 998-1037
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0438
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 225-260,302-332
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0673
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288423   Gene: FBgn0034085   Transcript: FBtr0289985
Sequence length 1433
Comment pep:known chromosome:BDGP5:2R:12058747:12065812:-1 gene:FBgn0034085 transcript:FBtr0289985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATNWKQSHRRIHALILILWIAGVQGQTVGSLVAVSESQELAEKVEVTVVSTVYTLGFS
ISNEADYSIDKVICRNGSGSETEANAAHVCENLNPCTFYTSVVSFRSNVSGKPPPSDQTI
YAYTEYKQPKTTVTSVVATANTIKVTWQTNDRACVESFGITAKATDYTKSFQLLNDKSSQ
TFVNLSACLTHTITLDTRNNASVVVDTDATDVDTQYAEPGDLVMNVTNLASGITMITWGD
PSEKNCISNYVFKWQRNDCGTDQNQDTTTDVPSTETTNEIDYVTTTPMETTPDTPSDEVK
CEWTDVSSDGKLREYLLTDLQGCDLYTFQVFINENSTAKASQTFTSAEKLVSAVYEPSPT
AYPTQLHWTWFSPQNHPKCVANYSVTLTGPIQRSENKTMNVITEETFAIFDDLDPCGIYL
VEIVPNQLNGSAGTKYQEQSTVGEDQPSVIQDPVVEAEAYSMEVSWKTPEYADLCIDGYR
LSGWMEDDKLVEVEALSITTQNTTVVFDKNLLACQVYIIQIIPYTKENLDGQLRQVGVET
KAAIVDYTKVKLEMKNAGSEFIDLIAFNADYNNSCPTIFALFTCNATTQVRNPYAERYVE
GHSKQGFNASLSPLSPYATYVCKVILYNVAGPSEPVVDADMHTTTYFPEQPESVMLEKST
VSSLLFNWQPPTYTNGPIKYYQAFLMRHEASYFVPADCAIVEQDTKSETKGDPSVNFTGL
APAVRYMMQVAAQNDFGMGVYTEPVIGITLPAVSDSVTQLTVLTQGPVNNNAVYEANVTI
TWKVPCKSNGDIEYFQLAFNGTRNNFAPVSFERRVELDTGNKQGRMSYTETEMQPQFDYT
VEVSVKNRDVEQLSSSVPGSWQSPAGLPTIPSDELIKQMRANVEETSNPTKTAIVRLPAD
IMTSASGDIKWMALMISQKNCAGVPHLKYDVSSDWPKVLSYQEAGADGTGDCSLEYQTTE
ERWHPEPVQRQRRDGEVTSDEEIVFTIGLDKCSEVQKTYCNGPLLPDTDYNVVVRLFTAS
GYSDAAVLNFKTKAAIKVTLILVSVCSCLLLAFVLGLTVLWVRKRLAWKRDSGQGIEDPF
GNVIAKNFAIFYTEVAKPEKLAREFKEITVVALELSYSASELGCHKNRYADIFPYDKNRV
ILDIDAEGSDYINASFIDGHTRKKEYIATQGPKPESVMDFWRMILQYNVRVIVQVTQFRE
GNTIKCHEYYPYNVRGLTVTIKSKEVLELYDRTELTVVHDKYGLKEKVIHYYFKKWPDHG
VPEDPMHLIMFVKKVKAEKRPSYSPIVVHCSAGVGRTGTFIGLDLIMQRLKSESKINIFE
TVKKLRFQRMKMVQTQQQYTFLYACTYELVKHKIPRAALKMDGRPKSVTVPAIPSPKKVS
FPDVDVGSEYVSSAPITDLDDGRPIVQLPSRFSGLRRNSPPGENDNPTSSSNM
Download sequence
Identical sequences A1ZAB3
7227.FBpp0288423 FBpp0288423 NP_611093.2.81976 FBpp0288423 FBpp0288423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]