SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288807 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288807
Domain Number 1 Region: 1395-1504
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-27
Family SH2 domain 0.00093
Further Details:      
 
Weak hits

Sequence:  FBpp0288807
Domain Number - Region: 2-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00017
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288807   Gene: FBgn0259109   Transcript: FBtr0299532
Sequence length 1510
Comment pep:known chromosome:BDGP5:X:12413012:12425266:-1 gene:FBgn0259109 transcript:FBtr0299532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCRLCWIDFNAGEAMVECAGPCGSCFHRNCVDCVTGDVAHILATGGGYYSGLEWYCRTC
RQLYRLQVYFEIAICDDYSLPVDFVKKRPSSFDPCLAEAIPANPEHWIAPSPQTEFLPFG
EAQQALQLQPAAAAATAAATTSAAAAANATAAAPQLPPPLPVPVATLPNQAATAAAAATA
AILATHQQQQQQQHQHLSNNNNNGGSTHGQQHTHSNNNNTLPVGAQQQQQQQHQQQRATL
QHPPLPNSNIKQASVKLIEGYSDPKDTRNHKKVYHKKAKKRSTTGHKRHQQQQQQQQPHQ
QQLQQQQQQTLPTPRSAQQQQQLQQKLQQRHSTYNNNNGNSRKDKRNSQYNSDSSAPKSS
DDEADIDEEVEQQPLPVPQAPVQSASQPAAGLNSPDSISDDLVRPLPPQLQRSPRKLTVA
PAEHNKRQPSPYYYSDLLKSRDKDKDKDKDKDKDKDKDKDKDKDKDKERDKDREDFKLKC
RQSTASEPPQQTQTQLGGYRKSSSLDVPPAEEQPEAESHEEEDPRTGQDSQSTPKRYSFT
EEGVHIIRCETPSTSTSEESDCSECLKRREWHARALALVRKTCNVQPRNQNPTGSELQLQ
LQHCDAGEGELLKCCPPPPAPAENQSQVQPMPPHRLLGPAAVCGACITSAPASSLAGGRG
SELGDDLEEEYFRPRSIFYVHPHGVHECIECAQPAQPATVPAPTLSNPSLDIYGDDEDEV
DGDEDEDEEDDSEDIMGSRRRQIYETAFDCKIAKSDDDLDEVDRITNCSVLLQLSNGNGG
DISKVTGSSKTRAECKRAKNSKNQALQEQTGEAHVQVHHVEAELGKLQLSQVDQQNQNQN
QSQNQQHGVSATGSGASASSTQQLPVRGYTPSPPSTAPLPMKFPGKHDRYLNMNSIRSAP
NLPAANPAHPRLRDLRLPIQSMRHQCGGSSNDNSLTDSAYVNPPSTNSNSNAASASASAS
VSATGSAAPRRPRSFVLESGRVLELRRSAQGHQGGQSTHHHHHHHHHAPGSRRNRHGQSQ
GQTTGGGHNYSSTESIATSSSGGSMESLRSSTSEGNRSTSSSESRHSSSLSSHSSESGSG
GSGGSGGSSVAYPLRPAPLLLHSKLHILSPISDKSSQEPASASASEQSQQPSQQLAPMAS
QEDDSTTSGAPAGNQVQVNASLKQPRSNRGAPNKALLQLADELLGSDSGISLHSREDGKP
QALALQRLTLPKLQLIGAEGTTTSATASGAGGSSATGGSSGAGGSGSGSVVASGSTGIQQ
DLRDLPFDMPKLRRRKTLQQEAACTSGSATSVDLGELPFDMPKLRRRLRANQAEINNLLM
HSTESSGISQASSSHSMRDDQKMSSKLDTALFRQNLTLNLNESRQATKQFGSLDLRGLNS
NKELNMNLSQGYVTAVDLIDVTIPLERQGWYHGAITRIEAETTLRPLSEGSFLVRNCEST
KQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMIRHFCLNRLPVRGAEHMC
LIEPVIAQLL
Download sequence
Identical sequences Q7KV33
FBpp0288807 NP_727617.2.81976 7227.FBpp0288807 FBpp0288807 FBpp0305358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]