SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289412 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289412
Domain Number 1 Region: 31-76
Classification Level Classification E-value
Superfamily R3H domain 0.000000196
Family R3H domain 0.0069
Further Details:      
 
Domain Number 2 Region: 520-585
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000513
Family Canonical RBD 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289412   Gene: FBgn0035388   Transcript: FBtr0300175
Sequence length 671
Comment pep:known chromosome:BDGP5:3L:3036393:3040469:1 gene:FBgn0035388 transcript:FBtr0300175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPHKRLTIHARSQRIELIDGLFTFSTAFFRSVLLFPPVGNYRRYLIHQTCEKYRQQYD
LFTFSVGQGPQRRTVLCFRNQLLDPSGFENRKQQQQREKDREREAARSWRSNNNSHYHTN
GRSSSASRRSATELCKMGVKKHISETPLSKSNSVDLYRPPALRNNSNNNNSSSEEAAAVN
EAITTPLAAGTATTASTSPTSKESPNREADASAAAAAAATRRERRPDRAVYVPRARRSQT
TPPTTTTTTTAAAATAVATTSPPAAAAVVAATITTAPDSPPVADTQPSKADDVNGQPPSK
SKKSKSHRERRERAKKTTTATTADNATVLVISASENDTQSNEEHRPAKPADCDKEIMSGA
QRTKPGNGNKSASNGKSQASPPLRIEDVVAARSTNGEEPAKCDNDVRELQRASKEINRSN
RRIMKQTFNSDVLEIPEKIETSATKAIPTSPQASATAKPPVDSTTEDDDEEDEDDWEKMF
DESGDCLDPKLLQELTESVGKCKIELPKMDYTVFHIKQQLLNEEEFPHVLEVSNFPVEFK
TPDLLMLFAQYRGSGFDIKWVDDTHALAVFSSSRIAAEVLTMGHPFVKLKPLAEATLESR
LKAKKAGAVSMQPYRQRPETCTALARRLVSGALGVKLPTAPQERENERRVLREAKERKLL
AAKQRDEVWES
Download sequence
Identical sequences FBpp0289412 7227.FBpp0289412 FBpp0289412 FBpp0289412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]