SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289481 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289481
Domain Number 1 Region: 8-93
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.93e-17
Family Canonical RBD 0.00011
Further Details:      
 
Weak hits

Sequence:  FBpp0289481
Domain Number - Region: 402-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0119
Family C2HC finger 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289481   Gene: FBgn0259935   Transcript: FBtr0300248
Sequence length 711
Comment pep:known chromosome:BDGP5:3L:7416927:7447719:1 gene:FBgn0259935 transcript:FBtr0300248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQ
FTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRKRQNVSKTGNDWDYFYDSYCS
SALLRGGGGAGGGGSNGVRAKKRKRLMTNGGGLAVAVQQQQQQHHHSAAAVAAAAAAAVH
QQQQQVQQQQQQQHHQQQQQQHQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTV
TAAPSSIHWSQYKQEQQHHPHAHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAIIANQTA
LGEPYPVGAAAFAAHQQQHQHQQQHQQPLLQPLTLALSPQQPQPHQAATPLQLHSQLMQQ
HQHQQQQQQQQQQQQQQHNQQQQHAQEQLSLHQQWGPFKVYSNPDTLICGNCRESFGELS
ELLDHKKSYCKLRFTCKCQDVAFAASAKTPPTSAKLLCAVCKDAFVNPWDLMVHAQAAHM
VNIYELGDDEGSSNSNATTASSNNVANAAVENGHTIADVAATKQQMPQMPDASSTLNKEP
NNNNKISNNNIISGAINGHMSPSGTGIIMASVSSAENGMASDMETNCLDIKFSPSASPKE
ASDMITAAPGSGSHSPVIPLQDQHRDDLSLDGRMSSSSQQTHHSDELNVKLLNGSVSSRG
SSPGLEADEPPATRACIVRTLSIETAGSSTAPTANTLSLMSNSLGLALAPQ
Download sequence
Identical sequences Q7KU81
FBpp0289481 FBpp0289481 7227.FBpp0289481 NP_996010.2.81976 FBpp0289481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]