SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290185 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290185
Domain Number 1 Region: 1118-1269,1327-1507
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.37e-52
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 923-1024
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-18
Family Ras-binding domain, RBD 0.0073
Further Details:      
 
Domain Number 3 Region: 4-56
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 4 Region: 116-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000114
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 66-119
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000436
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.043
Further Details:      
 
Domain Number 6 Region: 832-892
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000176
Family Ras-binding domain, RBD 0.043
Further Details:      
 
Domain Number 7 Region: 1026-1104
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000018
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290185   Gene: FBgn0051140   Transcript: FBtr0300963
Sequence length 1564
Comment pep:known chromosome:BDGP5:3R:19788902:19806716:1 gene:FBgn0051140 transcript:FBtr0300963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGGHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAP
CIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA
TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMY
LPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSKTSLVRDYSCPSPDLSCPIPG
AGSGSLTSLGLKELLELHRQRLEQSKQHFLLSTPPTPTSCGSISLCHSPTPSSLTVGETS
NEAEQDRERDQDQPEEEPEEENTEQDSALQLTTSTSNVIGNLQKWPSANSSLHLLYTNLF
RKLGQGKRRRKRGISSGGLSPSEDEDDVDGGVCDISGGDLSDDYDHCDVALRRRSLRSRQ
PRDVSETDYHGDAEAEAEGETVPRESCYETSDTGGELTNTDDLDSSLNLISNLSYNSSNN
SNACNVPGGATAPDARNTATTSTTAPGKSGHALSVQGGRQQPKTGALAQIKPKPKPILMP
KHKAQGKGGSLSSPLSNSNSSDCSSASPSAPATLLQLSPVGRSKSFQESAAITAVSRYKK
YGRGLFQRRRSKRSPKNAVGVGGKSNYSLDRLSQNIEITIQDEDGNFHPYDDNYHMLAGR
LDATDVDDDVGFDDLYLDDRPSGASDDVAFAGDISDGGASSRSRASDASDGHVLGRLLRQ
VRQGLSVGWRKPRYQKRRARSISEEFSSGDTPRFKDEESASKAESGHGPSSGGAGGGGGS
GGAGGSSAAGASASAAGGSSGHYRPDSGSGHKSDKSEKDREKKEKEREEKDIEMIKVFDG
NNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPT
PVLNLVHLEGKRPAIYLRFHDRDRGHVRVYPGKLQCSMLEDPYVSVPVDNSTVIKDLIRD
ALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQ
HKQDPHGPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDS
MKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSF
RKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGT
IGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAE
EIRLDRWTVVFHPEDKPEEPAMKAPSQTTGKKKKAHQAHLSQSQQTNQHHQLPALTSSDI
SGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKI
VGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYD
GMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVL
KSALKATMLKKNKLKMKRRNTEPTMMVAGSAAPPLSLALPPSVGEVGVAGEGAEGDGGTN
NTDF
Download sequence
Identical sequences Q9VCF2
7227.FBpp0083885 NP_651199.2.81976 FBpp0083885 FBpp0083885 FBpp0290185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]