SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290631 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290631
Domain Number 1 Region: 934-1226
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290631   Gene: FBgn0031294   Transcript: FBtr0301417
Sequence length 1319
Comment pep:known chromosome:BDGP5:2L:1011421:1048053:-1 gene:FBgn0031294 transcript:FBtr0301417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVGTSCGVPIIMARNVQQRQQHPCTTTEEPKHQRARGTAGHQESATGECQQFWSKQRP
PFDQQQQQEDQDPEQDPQQHPSTPQESVHHHRSPRQHELLHHQRKVPPTLPARGRHLISE
GARRREVRGCGAGGGGLLCCSLDALSRPAKLLQFGVLLLILLLATHGDLAQAEGNVGCQF
VRTLCIPHSEVCYDDNIFGKCIPTTGVDVEDIEKTPLTEDQSRVLATMLEELQGAGLGWD
HPYVQCRIQGSLFSLQRQQQLPPNLCANLAPTPPEFGDPASALAYVRFTPPEPEAELDYY
EQPAGPAQFYPALRKKQVRESDADDMYLNRMLQDRRRLRHDPSELEHFGKMDGHGQSTQL
DAPSIMDAFLDTERQRIEREQQLAAAEQDADRRAEQNRLELYQILAASEPDPQPYQRKPA
AQPNAMDQLEAIVEQQQQRELKEQQEQAKAPVYVPPEEVNESSELYFPDNFAPFKRARGR
SRGGLAEEVEDEQPKRSFFRELAGEQGLVQEPPLRFRHVETEVDATPELVKRRPASFKQL
DPYDVSLQQQEMAFESGLLRNSLTPLEEEAMLASNSFPRQAKSQRVYTEGGLLLMPQDEQ
DTDGMQADEPENVKQSLLANMLGFARHERLDVKKPGPLLGPPSLGSAELSNQLETEKAHK
QKGHGNKEVLPAHIKGNDEDDAHKKKKVMKQQHSAEDHAPHTVDTEYVHVFVKNPIDSWN
DGQRIMKELEQILHMQGYFSYLTVQQHEVSFRVNSNNPERKTAGDVARTINENRGVKNNI
QRRVGFYVLHAGVGDVIKDLQDPSVSSSRIELAEQGPDVTHIMAYMFAGAGAAAVIVIFV
TLILIKRHDRKRDKLGGLQSGIAGAETCSKDYQELCRARMAGKAGGGGNSTGGAAGGGSN
EPAPSGRITSLSKENEGRPPSSRSSTSSWSEEPALTNMDISTGHMVLSYMEDHLRNKGRL
QREWEALCRYEAEPSAREAASQPQCAGLNRPGAPLPYDHSRVVLNHLANAEGLDYVNAST
ITDHDPRAPAYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGEVACARYWPEEGA
EVYHIYEVHLVSEHIWCDDYLVRSFYLKNLRTSETRTVTQFHFLSWPHMGVPAQAKALLD
FRRKVNKSYRGRRSCPIVVHGSAGAGRTGVYILLDLVLERMNKGAREIDIAATLEHLRDQ
RAGVVATRQQFEFVLMAVAEEVHAILKALPANTSGEKRELDKDPVVGGGSSSTTTKEPLK
EDKAQEAAEEEAPTSSSKAAAAAKKEKEKDKDKEEKQAKDQAKVAEPRTPAKSAKQAKK
Download sequence
Identical sequences Q9VPV8
FBpp0290631 FBpp0290630 NP_608562.4.81976 FBpp0290630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]