SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291871 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291871
Domain Number 1 Region: 3190-3368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-33
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 2778-2956
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.55e-27
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 3 Region: 3003-3179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-26
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 4 Region: 2583-2773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-26
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 5 Region: 2397-2569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000162
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 6 Region: 1065-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 7 Region: 1150-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 852-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 9 Region: 1294-1342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000257
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 401-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family EGF-type module 0.094
Further Details:      
 
Domain Number 11 Region: 1670-1719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 12 Region: 1199-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 13 Region: 935-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 14 Region: 1726-1775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 15 Region: 1018-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 16 Region: 974-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 17 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family Laminin-type module 0.033
Further Details:      
 
Weak hits

Sequence:  FBpp0291871
Domain Number - Region: 562-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 1773-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 516-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.073
Further Details:      
 
Domain Number - Region: 1247-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 1340-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 810-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 224-285
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0741
Family APC10-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291871   Gene: FBgn0261563   Transcript: FBtr0302731
Sequence length 3375
Comment pep:known chromosome:BDGP5:2L:14263522:14328262:1 gene:FBgn0261563 transcript:FBtr0302731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIGNFIKWPLGLILILLVTHCQAKRQRKRLRGFSTAKDLQDYSMPLNDNSTELQQNIVS
WTGARIASSPDKKKKSPQSSRRHKTKSGLIIESNIADSESMLAIASSESVTKKKPPQRRR
NGKLQKSGGGAGGGALRLLKTEDVYSSSFSGGLYPPLFNVVPRAQISVNATCGQNGAEEY
CKQVGAKPCGICNAHSSDRAKQRSIQSLISSGSGSGSGSGFEEGWWQSPTLQGGRQFEYV
TILLDLKQTFQIFSVWLKSANSPRPASWILEKSLDGINFEPWQYFGLSDADCQRRWNLSG
QNGKYVFQNDTEIICSTQFSKPGPLENGVLHASLLKNRPGATDQSPELMKFITTRYIRIR
LQGMHSTANQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCNGHANRSHESPDDPLMQC
ICQHNTCGAQCEQCCPLFQDRPYQMGGECEICQCYGHAESCTYDPFLDKGICQSCSNNTA
GIECEFCEMGFYRELDAPLTDPCLPCSCNPARSTGGCQSDGGSCNCLEGFQGKNCEECAP
GYYGDDCKRCECDERGSLGSTGSCSGVCQCKLNVEGSTCSECAPGYFDLSAENAEGCTSC
WCSGVSQTCHSAKLQTLAFETLNDWKITDIQRVKPISIPVDAETNRLIFANELDEVEAIY
WQASLGYLGNRLTSYGSRLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKIAFGDESLD
GLGINLNVTLTEVGWYHVPPTVVDIKTRLRRTEGGDYHGESVTRSQFLSVLVSLDAVLIR
AAFHTDQGETSLERAVIYSGGVELGGKSSSQVEQCLCPAGYTGLSCEGCAFGFKRIYENT
SDHQILSKCIPCPCNGHSNSCDLQSGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPNDCK
RCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGDHCQVCDDGY
FGNPRQPGSSCQRCDCAGGPCNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHC
HTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLGSLVQDRCDP
HTGQCHCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPN
SESTVACEECHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCR
CDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPH
NGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQCQCREGYS
GRKCDTCAIGYFGYPECRRCGCDAEGSFTQADGSIACDSNGQCPCKSLVVGLKCDTCMQS
TFGLSAQNPEGCTRCFCFGRSGECEQSDLSWGHIRMAESRNLSVQQIRPHSVPSSDYEYI
VVVQMEGSSFHREDAEIQRMNDLSLVPKSTGNVSIGAYGQFYHPLYFQLPPQFYGDRTSS
YGGFLYFTLITEGAHKPLERNILGQYPLVQLHAHSKLLLDFYEYEEFEYSLNVTHRVPLH
ESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNVHMDAAIYIKGSTNL
IAKGVERCKCPKRFDGLSCQDPGRSFYRWRNTTIVESVFIEDLIGRAAPCHCNGRSSDCD
RETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDGEVSC
VCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCYCREGVTG
LKCDKCQAERHHLVDNGCKICDNCTLLLLDYMELVGNKLRRGMHNMDLTGIPAPYRKLSE
YESAYEKWNGRHWDFSQTKRRLQDYDSADILKLEAHAENLKFQSRKAVATIGKREFAIKS
MREDAVTQQHSVGLLRSEILQTLSDLHGYGKSAHYLSLPTALKQARFYLQAIREHDQMVQ
GIRSTNDCAWKHFYAMGNASDASFDESGRLEMLWRDLNQTNHRVVDMRLQVDRVQEVENE
AEDVLEHVRNLSIRVGESHQELDELNQRISDHLDPGYLEQGEGLLRLTVQRQIMLNGHLN
QLDGYRILLNTTLGVKTEQQREVRKHWLPKAEKHASHLLARSNEYARKFQPTRNGARIAM
LASSAHSNITEAINDARLASILAKERVYEAQRTLYPSDGSSMIERAKHSLHRSKQLQQEA
LKQMHKSNVLKDKLHRQEQQVEGIKSTIYDSGLRTNNISGQLQGLSDGSARRQAKDSLEM
ADRTGEQMRAELQKAKDMQKSIQNMRNSFSNLEPDWEIKLGMAQENISLTQTNLRLANVS
LSYLEQQAEKEQQVFEVWNNSMAQQLQQLRDQIAKARHAAEAIDVSLESLGPKCIRSYLP
ASYGLSTSNKIRMSFALSNHLESSPLIHLASSEGRHITLELYKRRVRLVWNLGGTTATVT
HPMVVHTRDPKYDDAWYHVEANRTLNLGSLVVRRMNNYGELTPPNPVIITGSTDTEHTRF
YQSRSDRISLGGFASKDLQFTPGLNVVVHQVEVDNKPLGLWNFVTSEGSCGGSMVGAKES
SASSTARHFNGLGYAQLMKTRPRPTRKNLFSVQMTFRTLDENALLFLAVDDKNNRSVSVT
LSRGRIMFRIDYGDESKLEINTTKKYNVGQWIKIEAAREFSAKRSTENGMLRVNNDRPIS
GAPTLPVNIHLLPDLSKTVYYLGGVPPGFTSGTSKAPGADNPFLGCMKDVQVNGETYDPL
ESSSYYGVEPSCKNMITKAGFSGNGYLELPSQSLRKRSNTALVFRTLQPDCLLLLAAYPP
EILGDYDAKDIKGNFSISLVDGQLHVWVNSGRSFIKMSSNSSQMNDGEFHVVHLIKTGRK
LELMVDDELQEIRNLNGNPTVVSLPRDAGGLYIGGAPPHESYTPLAPTFVNLEGAIRDVV
FNNRTINFNDALTFANVQIGRNGPLMGSLKGGLYDVLLKTEPMIGKSFTASPEGCKRIGS
YSYEPNAFKFGDDIYSYSQLKLPERHFWQRNFHLSFDFRSFYPNGMLYLSPGSKEKPKHY
VALVLKDGQLVLVVRGRRREELQLTAKLNDGEWHRVTISCHDRKVTMSVEIGRTDQKTSA
QMKLPKKIGASQLLLVGGLPQSPVKVSSDLYVRLEPFKGCLRRVSINNNTQDLARPGKHS
NVGQCFPTVERGSYFPGDAYAIYKKNFNVGKYLDLETEFRTSELSGILLSVSDPNGFPAL
SLELHNGNIIFSCDPGNGAPMRVESSLPTKYALCDNKWHNISALYDGEQIVLRIDQLPAV
ISVGNQGNAGKVQTRSPLYIGGLPESAPSGSLISRENFKGCIRHVSIRNERRDWIEMEDL
RNVLLSECLVSSDES
Download sequence
Identical sequences Q8IP51
FBpp0291871 7227.FBpp0080193 FBpp0291871 FBpp0291871 NP_723870.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]