SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293396 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293396
Domain Number 1 Region: 380-472,805-888
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.43e-41
Family Canonical RBD 0.0000293
Further Details:      
 
Domain Number 2 Region: 282-361
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.07e-20
Family Canonical RBD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293396   Gene: FBgn0262475   Transcript: FBtr0304856
Sequence length 893
Comment pep:known chromosome:BDGP5:2L:12344381:12397528:1 gene:FBgn0262475 transcript:FBtr0304856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLQSLSLHADKLSGNSPAAAAATGAAAATSEATAVASAAAATTMLATAPVAHVANGNNS
NSSAGSSSNSNSSSNNHSLYSNNNLNTGNNSQQQQQQQQQHPQILPVKYEYLENLTSSGA
TSGAIAATTTFTGAAKSFHPYLRPTGSGSNSNNSIAALSTTTAATAAKMSTTLFETLLHN
QINSSPIALPAATAIAAISAAATAATATPGTAATAAAAAAAAPSTQLNSSINSRTSLGDQ
GGAIVVVTPAPPVAAPPTGGPNRNQSPTRDCSVKMELMESTSPDSIKDQPDADNIKMFVG
QIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIK
TLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQ
SKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQIHAFCGI
NTPSGATAGAATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVP
LNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLP
GLNFHHPPENSAHHSQHSPGIGGASAASLSAAAATAASNPLGGAPPPTPTPTSSAGHAAG
AGLLAAPSMSMQNLVALLATPTAHHQLSLHHSSSSSGHNNGNSSATSGLHNQRLTYAAAP
PPPPISTTYNMPQLIGHTATPTQPGGSSQSLTFNALWPPNAADPYSSSLSGLTNGAAYGA
ASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPFGNVLSAKVF
IDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSKDAAKPY
Download sequence
Identical sequences Q0E8R3
NP_001036356.1.81976 NP_001260411.1.81976 FBpp0293396 FBpp0110257 FBpp0293396 FBpp0304532 7227.FBpp0110257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]