SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297244 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297244
Domain Number 1 Region: 1739-2011,2038-2064
Classification Level Classification E-value
Superfamily NHL repeat 1.31e-22
Family NHL repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 1430-1520
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000628
Family Pre-dockerin domain 0.047
Further Details:      
 
Weak hits

Sequence:  FBpp0297244
Domain Number - Region: 1171-1195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 1140-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 1104-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Integrin beta EGF-like domains 0.056
Further Details:      
 
Domain Number - Region: 1270-1296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 1075-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family Integrin beta EGF-like domains 0.075
Further Details:      
 
Domain Number - Region: 2785-2899
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0628
Family Cell wall binding repeat 0.016
Further Details:      
 
Domain Number - Region: 1240-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0656
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297244   Gene: FBgn0004449   Transcript: FBtr0306107
Sequence length 3297
Comment pep:known chromosome:BDGP5:3L:22287084:22400987:-1 gene:FBgn0004449 transcript:FBtr0306107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPYEYESTLDCRDVGGGPTPAHAHPHAQGRTLPMSGHGRPTTDLGPVHGSQTLQHQNQQ
NLQAAQAAAQSSHYDYEYQHLAHRPPDTANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNP
TMSRMQNGRLTVNNPNDADFEPSCLVRTPSGNVYIPSGNLNINKGSPIDFKSGSACSTPT
KDTLKGYERSTQGCMGPVLPQRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVL
FAFVVMLILLTTTGVIKWNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQG
IGLAQGQSGLGAAGVGSGGGSSAATVTTATSNSGTAQGLQSTSASAEATSSAATSSSQSS
LTPSLSSSLANANNGGRAMSTRLSVRGAGERGRRHRRSLNEEQGEDDVATDGTFSDLITN
ESLNQQAAEKYLATTLAKSPTDVHGSGNKTLPRMDGVYGTQRSEDTPDTSYDYVYEDEVE
PETTPSLIRRTKTGQQFGKSLNSNLRSAAKTLVNKRRKYDHGTVEAEHIKHEEEEEEDEQ
KLERHEAIGMATELTTESETSTLPAVIDDDNQSDNSSSGPTPETTVRSDTDDIVEINTPP
SQTAQRTFAAVSHQPAIEHDFQIKGTDAGGLQTEKPATDDINNERDLADNYEVDSKEPTS
PGTPPQGKVSQQTGKASLQSLQSESDLMMNDASHYEDIDIVKLDGLTISHEEEIYKTADK
ENMAPKNQPSQHIDRSQNEVLKGHQQGDEKQPQLEPLKPYVSERVDLPGKRIFLNLTIAT
DEGSDSVYTLHVEVPTGGGPHFIKEVLTHEKPTAQADSCVPEPPPRMPDCPCSCLPPPAP
IYLDDTVDIDSAPPAKTVTTSTISAPINPFHSEEEDDEDGVRDEEQTPSSSTATNLPSTE
IDNHIAAFTEPAVGAGGVPFACPDVMPVLILEGARTFPARSFPPDGTTFGQITLGQKLTK
EIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFSAST
RTARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQ
CLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADC
SGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCICKKGWKGPDCATMDQD
ALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGG
EYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECR
CYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLL
RKQPPAITASFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVVTSLGM
GLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVI
IDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQGACPDRSAILAESQVIQ
ESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEAD
PGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGG
WNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPDCDGQATKQRLL
APVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSD
PESHQIIRVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAIS
SDNILYFADGTNIRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVS
PMDNTLHIIDDHMILRMTPDGRVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGP
LGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNT
IAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVST
RNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMT
RMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIE
LSFDLSVKGAQVKVSENAQKEMSLLIQGATVIVRNGAAESRTTVDMDGSTTSITPWGHNL
QMEVAPYTILAEQSPLLGESYPVPAKQRTEIAGDLANRFEWRYFVRRQQPLQAGKQSKGP
PRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGD
YADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKV
TTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDE
GQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRR
EFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNARLSGIEMAIDDKELPTTRYKYSQNL
GQLEVVQDLKITRNAFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYD
LRNRIKSQKTTFGRSTAFDKINYNADGHVVEVLGTNNWKYLFDENGNTVGVVDQGEKFNL
GYDIGDRVIKVGDVEFNNYDARGFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRS
RLVAWHDNKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYV
ATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQ
RQYDPHVGQWMTPLWETLATEMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGY
DLNNMQSSRYTKLAQYTPQASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLK
MEPKMRNLLPRVSYRRGVFGEGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDL
HFSIHDQDVFYFVKDNVLKLRDDNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAV
VIIKYGVDPEQERHRILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDV
DGWNGIDIHSIHKYPQLADDPGNVAFQRDAKRKRRKTGSSHRSASNRRQLKFGELSA
Download sequence
Identical sequences FBpp0297244 FBpp0297244 NP_001097661.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]