SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300570 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300570
Domain Number 1 Region: 3823-3861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000749
Family EGF-type module 0.025
Further Details:      
 
Domain Number 2 Region: 3657-3699,3826-3913
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000863
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300570   Gene: FBgn0053978   Transcript: FBtr0308250
Sequence length 4215
Comment pep:known chromosome:BDGP5:4:178201:195766:-1 gene:FBgn0053978 transcript:FBtr0308250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQPREDNKISDIFHKKYDTSTSTRRMMYSTYYNFNLSRVLFTTLLFTMMHIETSHAINQ
SYHVSPTPTLPAISGDDITTVLLVNNESGHMGDFHGRFLTVRPEIGVLKSTARTFIQDGI
TTEFATKIVGTTLNNGRLYAQYLKKSSRVLYENENISPSVVTSWVGEEDSLQTPLVLQSH
NDLFNIDDSNWQDIDDSIGAHQREFVGNTDFVNEQNTKNKVLEAPALQDKKTISYMGSDS
NDTLRTDFKKEDEINRLIEVLSIKHLETYTVKMPFGNYPTSSLNQSHLDHRKERKYEHLM
QPHTEKKNEDHNQKSRSDHKQVLASVTYYGFADFTTIVGDSVIVFSPSTTQSILHYGHVT
SIKGKPTLQHDLIPEEIAQTSKISLSTLKMGTSSGKYEEFVSNISASKMFDKNELKNLSV
LKPTNPSPTFANNSFNEEQEASSVLSKDIVPFVSKAFNDIISPSFVNGVKEGTKHNEPSI
IKQEGATTVFIDDDPFTSFDDLSGSTSLKLNSANEIKSIKSFEMSKSDEIREIVAYQTNI
NFTKDSLDINPLFETSNENHDFEELCNHTTSQVFLTQMSKANISNEKNSMDTIDIDANPL
HAYEIVETTKYYCIQASQSKQTPELDIIVTHETFTKSRGEFVSTYSIDDDIDETTVQDLG
DYEGTTENEYESEEEEYESVSDEVDLIYKTLYTTYTYLTTFFEGSRTTISSHTEVLTNIV
SSTLLPKAKLKSNTLNYVGENQISDNTIRLIDHKTTEFSQKYSIPDEIASLLIQESKVNT
AESSSQMMTTLRDDLIYSKTLLTTYTYYTSIFTNNETEVQSRTEIVTNYITDNVSNNETN
FIRNPQTANLNFLKSQHSLVEEKIDKVVNMAYGMSVNSSMLRDSSPASFINQNLLDDQVS
SESNTEEIIPSATFLLQTSFTTFTFYTTMYVGNDTSIISRHETITNVATEALHPTKLISV
EDYSLPITYFTTFTYWTKLAKDGEITTLSREETLSNVIQHSNGTTLTVNDLKTADKVSSQ
STATDSDTENDRNCKSESSLFSTLENQIYQSDITTFYTTYTYYTTSYDVNTTIIDSRLET
VTNIITSREMSNPMEETDATILMIKPSQPIAYYENPIETIKPNVVLYDYKQIIDAENIST
LYFTTEIVSSMNSEGYAIKLTSSTSRLHVDQSKKSRMSTIYGKIPDDSLNLYKTGLVRLI
EGKRIQNSTTTLYQSRVIGTLIENRYAQIIESTSSFFFEKTKSEHILFPTSVEISGMITK
NVDLIDVIESTKSENDTTVAPYIDQKNTKPESDNTDGLSNHSPQNAKRPFAPVIRPFASR
NRPTFAPKQKTLVPSSATIITRSDITPTITATPALKAVGRYTASRRGIISNVPINLNEPN
LSQSSQSSRRLFGRPSKSMYDLIEANSTLQSSNAFSPSKTRFTSPLRPGVSSRRPNINIS
YRSSSFPVFRGSGVIANTRLRIKPTSIGIQSSYRPTQSTTFATESSSEDSVEEDTSPDEE
SDVEEGIKNNNNSPLLRFRRPINAPSGFSPPIRQTGNSPVVSLRRNPLSPRAKISTTTSS
TTTTTAKPRARSFQRPIGPHPRSRPQNTLFPPRGLFQTQIKNENLKVPRTNDSVPNNDFE
YEGGVEDQDLDENIHRRKRSIKYSVRFTTGNRVRRQADTVRRNRFRFRRQNQTATTKVES
KLMDSDNNTEPILTPRDKSSSRFGSRFHSPQVHQLYTQALIAESPTATNHRSIRPSRPTT
KRPQFTLREKDANLKGTASKNFRRQPASGNSRRPVGNSGNSNSRRLKSYVSYNKNNLDNG
RPSSSPRSRNSNSNTLNRGRSRGRNRVDYASDVQSVENDLQTITVTHYIPSEVTVPVVSG
HITEYKSIVTAKSSTEIVGPNDFAVVLGSNGISSTYLNRETSIINIAGATEHTKYLLHES
ITSSVTFTPTTIRGRKTSFSHIIPSTAYSVEYIVTTMQPQISENAPLANILLSQLLLGNL
NLPAHPLIGAVGQQNVPSTIIPTSVEPITEYRTHTSTYVTTIFDGKSTILPVTFQGKKIL
TTVYDTTAQTITATEYSVDTIINTLPSVQSVHTVGPAAHVNNLLLQQLLIQQQHESLVQA
ISNPTPPQVLLSENLQVLDDGTRTSIKSDAIDIEYDSDLVSVSNESQPTKGHRKKSRKSS
SGNKRSKQEPSVITLYVSGRRPGEFSTVLSTVKNEHDHSVSLQKRHAVLEIQPTNSIKYV
SSIERSKNIMEKNDILRDIRSSLTIDIGFNDLPDQTASLESIVGDVDLCLKTVRCFACRF
ESRCAQPIIFVLFHTKYIADRNADSQYETPISNPHKFYIIFFKLSIERNQLERHSFKEHR
ETKKFNTSYELKNENNFLHGSISEKVLDEARYNLATHLMSNGVELIITNEKEKYIENIGL
TTQKVTSNNSQPILITIRSDKPLTLAPSTLKNQLTLSLPPIRKDPPSIPKNVFVRKICLT
TYTYHTTNVKNGSFHLVSKKVVITNSFTEDRNYLQASNSMIADVTFSKTPDLLVAMYPTT
YHYFNTIDRGQSTPIMFTSKDTVTSTIMRPKHSLALPHSIIDVSPSTKTYFSYILFTRTL
YDELGNSIHITRKKNFTEVVLTQPFHDSTYMNTKVTDIVSSVAQFNNSSSSAMNYEESDY
LIIYSTKAMLETQTFCTSIYNSSLTITKEACERDIRVPNHQLKRQTHLIKNIITDTVGSS
LLNSNILLSLKSKLLLISNKHKRESIVTIITLLPGEIIRVTGVYIIQTPNLNIFATSKKQ
NIFISSTISLLSATSMSSERNPTLITKKADFDENFRKELKNDSLYTSPFTYNNTELMLSA
SENSDIYIRTKNKLIHSRLSSATSKTSAIKILGLESFRPVVNVVAHVLTKQFVNLQKDQP
YTQYNEGCPKSNRIQSQTISTVMEQPVYIPLAQNISEELKENRLKSDHLGKLNISILHIY
PPRMDALRNTKKNISARHEYAGYMKTSRIYENELMNTGIPIRPGEVITANANVIFGRPNI
NVGVSHNFNENKMTVNNRHTISLKSLPLNNPTYSNIWDNSQNKRAKIDYASMLKPAIPIN
HQKQLKSATIHSRFSPIKILQKNPSLKYSSSFNPIIHLDAAFYRHHILDIFRIPQKITSL
SVSKSYFAMSNSPEYSFSQDVHHDPVKTSLSNVTPLILSKLSIVQQIKLKSNVISHTINM
HAGPLTFETESESIPYATTVKGYTGTFFISHIKIPIRDEKIDVHITPNRKSLLSHEYDNL
DHDKYYNKVKFHGVSFGSIMAPNKKPDVYQNDFPSQPTARLDSTHNGELTKHINEAPYMN
VKAFTEPDQTAAFNNFKNKNLFSSTILNKMWSVISTNSKSSTKKNCTEDLCKLFLAKYAN
SHPKYFTEHSGINTTVPKPSNFSAYYSSISSEYNNFTSSLTSRGLTSINDIKVQTSNMEL
SNSLLYNLGSLRTIQEPHFEPGQDLLSVTLCVTRNVKNCKNSLIHKLKNDDKMLEPSEIM
QDDTNSLLQKSMEADFVSLAVKNSITEKIAKNLNTLEVVKTEVIDAQKYIDLKNIIVNTS
KTNVMKPVFISVQKVLISQDSSYVSILNGSEYVVDPYNVKDYSIPSGSGDNFEMENIQSF
SRHTDFRNKSSSSLISNSKPDQIINASSDLRNMPFRADLIDSMSQRIDLIKQKSKTACDP
KCRLNKNEICVTYGNSTESIGICECRPSFGRMFPDRPCKPTYTYEMRIQTYWTENHLLKF
SNNIKSNSLIEYRHISKILLEAADRMVMQSDYRDIFHGVQLQSVFAKTNDTLMVTYLLQL
SENSNEDQLTTVFQKYLRQSNFSIGGTRLYTSREGLQFLTIKDFDECRNEHFYDCSPNAQ
CFNLIGSYTCSCKKGYVDKSENSLYPGRHCLNNIIGCDKCNYNGKCVNVSAEKSHKEIAI
CKCYAWYAGTKCQVNLKVIILFILTSGAILSLVLFLFLLIITKRKKQVDWKTSQLFIASS
SLSPSLTTSTKSVREMENVGELCKVMTLISKKEYNEVNNHFISPETHKKTIVIENYTNAI
ASTKVQDLNIKGAFTQNDILYGSTDRGSQHEDQINRSLTLRIPRAKFRFPDISQNSCLCH
KGKRSSLNITGKILVQKDDDYMAAYRSFGPSCEKDLKYLTLSDNLFYRGNTVAKADLVPV
GYGVSSLITDQIESPTLDENISINKAYSNSSSALNEDSNTMTERDLGSTFLLPHTHLYKT
DKVCCSSRYYLRNLN
Download sequence
Identical sequences FBpp0300570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]