SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300810 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300810
Domain Number 1 Region: 3892-4099
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-36
Family Laminin G-like module 0.00046
Further Details:      
 
Domain Number 2 Region: 4401-4609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-28
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 3 Region: 4146-4349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.32e-27
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 3129-3215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 3035-3118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000103
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 3220-3304
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000169
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 1616-1698
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000059
Family I set domains 0.061
Further Details:      
 
Domain Number 8 Region: 2937-3012
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000623
Family I set domains 0.043
Further Details:      
 
Domain Number 9 Region: 2745-2838
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000109
Family I set domains 0.035
Further Details:      
 
Domain Number 10 Region: 1580-1618
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000694
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 2840-2930
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000733
Family I set domains 0.014
Further Details:      
 
Domain Number 12 Region: 3430-3537
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000172
Family I set domains 0.032
Further Details:      
 
Domain Number 13 Region: 1371-1455
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000598
Family I set domains 0.017
Further Details:      
 
Domain Number 14 Region: 3750-3830
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000187
Family I set domains 0.035
Further Details:      
 
Domain Number 15 Region: 1537-1572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 16 Region: 1319-1355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 929-966
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 3826-3907
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000962
Family I set domains 0.022
Further Details:      
 
Domain Number 19 Region: 3517-3606
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000182
Family I set domains 0.035
Further Details:      
 
Domain Number 20 Region: 644-680
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 732-774
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 22 Region: 3631-3672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000916
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 1494-1532
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 1158-1194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 25 Region: 1061-1097
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000929
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 26 Region: 4087-4129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000149
Family EGF-type module 0.013
Further Details:      
 
Domain Number 27 Region: 979-1019
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 1280-1315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 29 Region: 517-553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 30 Region: 879-917
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 31 Region: 560-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 32 Region: 477-512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 33 Region: 1100-1137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 34 Region: 2344-2393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 35 Region: 1208-1244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 36 Region: 2001-2049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000297
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 37 Region: 1247-1281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 38 Region: 844-879
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000681
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 1025-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000956
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 40 Region: 2307-2346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.076
Further Details:      
 
Domain Number 41 Region: 391-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 42 Region: 3344-3410
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000306
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0300810
Domain Number - Region: 600-636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000406
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 2654-2691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 1937-1965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 356-388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00497
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number - Region: 228-265
Classification Level Classification E-value
Superfamily SEA domain 0.0183
Family SEA domain 0.011
Further Details:      
 
Domain Number - Region: 2061-2103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 2426-2463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300810   Gene: FBgn0261451   Transcript: FBtr0308586
Sequence length 4621
Comment pep:known chromosome:BDGP5:X:2364493:2439423:-1 gene:FBgn0261451 transcript:FBtr0308586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSPGSQASAIATSVGIRSGRRGQAGGSLLLRLLAVTFVLAACHAPLLTNAKQISNLGD
DQDFMLADDESLQGINDSEWQLMGDDIDDGLLDDVDETLKPMETKSEEEDLPTGNWFSQS
VHRVRRSINRLFGSDDNQERGRRQQRERSQRNRDAINRQKELRRRQKEDHNRWKQMRMER
QLEKQRLVKRTNHVVFNRATDPRKRASDLYDENEASGYHEEDTTLYRTYFVVNEPYDNEY
RDRESVQFQNLQKLLDDDLRNFFHSNYEGNDDEEQEIRSTLERVEIELPTSVNDFGSKLQ
QQLNVYNRIENLSAATDGVFSFTESSDIEEEAIDVTLPQEEVEGSGSDDSSCRGDATFTC
PRSGKTICDEMRCDREIQCPDGEDEEYCNYPNVCTEDQFKCDDKCLELKKRCDGSIDCLD
QTDEAGCINAPEPEPEPEPEPEPEPESEPEAEPEPEPEPEPESEPEQEPEPQVPEANECQ
ANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDG
HSDCSDGDDEEHCDGIVPKLRYTCPKGKFTCRDLSCISIVHRCDGRADCPNDRSDEEGCP
CLYDKWQCDDGTCIAKELLCNGNIDCPEDISDERYCEGGYDSEECRFDEFHCGTGECIPM
RQVCDNIYDCNDYSDEVNCVEGEEEDRVGIPIGHQPWRPASKHDDWLHEMDTSEYQVYQP
SNVYEKANSQNPCASNQFRCTTSNVCIPLHLRCDGFYHCNDMSDEKSCEQYQRHTTTRRP
LTLATPTSRITTQGPGLLERRNTTTATEASRWPWATKTTTIATTTSNPITTVGVANSPPQ
TCLENIEFACHNRDCISIESVCDGIPDCGRNEDEDDALCKCSGDKYKCQRGGGCIPKSQV
CDGKPQCHDRSDESACHLHGRLNKTRLGVKCLESQYQCGDGSCISGYKRCNGIHDCADAS
DEYNCIYDYEDTYDTDPNNNPLNECDILEFECDYSQCLPLEKKCDGYADCEDMSDELECQ
SYTDHCLESEFECDSYCLPRDQLCNGIPNCQDGSDERNCTFCREDAYLCNTGECVADNQR
CNGIADCADGSDERHCARIYCPPNKLACNGTCVSRRIKCDGIRDCLDGYDEMYCPETNNH
YPTQNVNVIRPKLGPNPIPKSCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFG
TATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYT
ESERCDRHRHCEDGSDEANCCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQE
CLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKE
SREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYA
SYIPGQQVTVNLNVERSWGENKYEEIRSNRIRYGTVPHIDLEFFGLDNDVGSRPESACTE
YQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCSNSKCVDRTWRCDGE
NDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLP
IRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGGTGTLRCPDMR
PQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVA
KACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHF
SGRETPYLALPADYMGNQLKSYGGNLRYEVNYRGSGRPVNGPDVIITGNRFTLTYRVRTQ
PGQNNRVSIPFVPGGWQKPDGRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIAL
DSAGTADKGLGSASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSCPSG
TYGDPRRGVPCKECPCPLTGSNNFASGCQQSPDGDVVCRCNEGYTGRRCEQCAAGYQGNP
LAAGGICRRIPDTSCNVDGTYSVHSNGTCQCKDSVIGEQCDTCKSKSFHLNSFTYTGCIE
CFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSF
IGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGED
LRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTS
TKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGL
CRPCECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYVGDATRGTIYDCQPDEGYPIP
SPPAPGNQTLECTAYCQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKE
CYCSGLASQCRSAALYRQLIPVDFILNAPLITDESGAVQDTENLIPDISRNMYTYTHTSY
LPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIWSRPDGNEN
QEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVIL
ESAVTTRTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCD
LVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQIIVSIQKPEITIVPVGGSMT
LSCSGRMRWSNSPVIVNWYKENSRLPENVEVQGGNLYLYDLQVSDSGVYICQAVNNETAS
VFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAPRVTWARVDGHAD
AQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYIT
PEEINGLAGESFQLNCQFTSVASLRYDWSHNGRSLSSSPARNVEIRGNTLEVRDASESDS
GVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEAS
GSPYPSIKWAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGSDLSSTSIDIE
PRERPSVKIVSAPLQTFSVGAPASLYCTVEGIPDPTVEWVRVDGQPLSPRHKIQSPGYMV
IDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVG
SGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRV
EVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPL
NTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKELVLMPL
PRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDVHWSTDNNRPLPSSVRIVGSVLRFVSIT
QAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYG
VRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVS
IDLQVLNFKSSKLSSAKPIISGPATTRAPAISYVCQPNDFKCVSHPHTCVRANMVCDGIY
DCTDHSDEFNCIAGKGSGKSESNSGSGSFKRWKKSPEQGRRSLAKAVKNRKLRKRSFAAT
PPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTDVVWERSDGAP
LSNNVRQVGNRLVISNVSPSDAGNYVCKCKTDEGDLYTTSYKLEVEDQPHELKSSKIVYA
KVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYA
DGETADFPNILVVTGAIPQFRQEPRSYMSFPTLPNSSFKFNFELTFRPENGDGLLLFNGQ
TRGSGDYIALSLKDRYAEFRFDFGGKPMLVRAEEPLALNEWHTVRVSRFKRDGYIQVDEQ
HPVAFPTLQQIPQLDLIEDLYIGGVPNWELLPADAVSQQVGFVGCISRLTLQGRTVELIR
EAKYKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCICQPGWTGRDCAIEGTQCTPGVCG
AGRCENTENDMECLCPLNRSGDRCQYNEILNEHSLNFKGNSFAAYGTPKVTKVNITLSVR
PASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTR
IEIRRRLGEGILRVGDGPERKAKAPGSDRILSLKTHLYVGGYDRSTVKVNRDVNITKGFD
GCISRLYNFQKPVNLLADIKDAANIQSCGETNMIGGDEDSDNEPPVPPPTPDVHENELQP
YAMAPCASDPCENGGSCSEQEDVAVCSCPFGFSGKHCQEHLQLGFNASFRGDGYVELNRS
HFQPALEQSYTSMGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDG
EEAVIRNSDIRVDNGERHIVIAKRDENTAILEVDRMLHSGETRPTSKKSMKLPGNVFVGG
APDLEVFTGFRYKHNLNGCIVVVEGETVGQINLSSAAVNGVNANVCPANDDPLGGTEPPV
V
Download sequence
Identical sequences FBpp0293691 FBpp0300810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]