SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071061 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071061
Domain Number 1 Region: 180-421
Classification Level Classification E-value
Superfamily vWA-like 3.78e-80
Family Integrin A (or I) domain 0.000000559
Further Details:      
 
Domain Number 2 Region: 405-509
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-23
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 690-772
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.59e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 600-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Integrin beta EGF-like domains 0.0067
Further Details:      
 
Domain Number 5 Region: 37-85
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000251
Family Plexin repeat 0.0059
Further Details:      
 
Weak hits

Sequence:  FBpp0071061
Domain Number - Region: 646-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family Integrin beta EGF-like domains 0.0071
Further Details:      
 
Domain Number - Region: 521-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071061   Gene: FBgn0004657   Transcript: FBtr0071105
Sequence length 846
Comment pep:known chromosome:BDGP5:X:7955680:7964270:1 gene:FBgn0004657 transcript:FBtr0071105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILERNRRCQLALLMIAILAAIAGQTDAQKAAKLTAVSTCASKEKCHTCIQTEGCAWCMQ
PDFKGQSRCYQNTSSLCPEEFAYSPITVEQILVNNKLTNQYKAELAAGGGGSAMSGSSSS
SYSSSSSSSSFYSQSSSGSSSASGYEEYSAGEIVQIQPQSMRLALRVNEKHNIKISYSQA
EGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVST
IPKKLEHPCENCKAPYGYQNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIAC
RSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQDYPSI
SQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKIS
SSVEMKDNATGDVKITYFSSCLSNGPEVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDW
TQTIHISPVGINEVMQIQLTMLCSCPCENPGSIGYQVQANSCSGHGTSMCGICNCDDSYF
GNKCECSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCE
CDNFSCERNRNQLCSGPDHGTCECGRCKCKPGWTGSNCGCQESNDTCMPPGGGEICSGHG
TCECGVCKCTVNDQGRFSGRHCEKCPTCSGRCQELKDCVQCQMYKTGELKNGDDCARNCT
QFVPVGVEKVEIDETKDEQMCKFFDEDDCKFMFKYSEQGELHVYAQENKECPAKVFMLGI
VMGVIAAIVLVGLAILLLWKLLTTIHDRREFARFEKERMNAKWDTGENPIYKQATSTFKN
PMYAGK
Download sequence
Identical sequences P11584 X2JAU0
NP_001284998.1.81976 NP_001284999.1.81976 NP_524793.2.81976 FBpp0071061 FBpp0071061 FBpp0071061 7227.FBpp0071061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]