SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071238 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071238
Domain Number 1 Region: 927-1184
Classification Level Classification E-value
Superfamily NHL repeat 6.02e-27
Family NHL repeat 0.00000528
Further Details:      
 
Domain Number 2 Region: 315-377
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000595
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 157-191,223-231
Classification Level Classification E-value
Superfamily RING/U-box 0.0000261
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071238   Gene: FBgn0026206   Transcript: FBtr0071303
Sequence length 1189
Comment pep:known chromosome:BDGP5:X:9057300:9065710:1 gene:FBgn0026206 transcript:FBtr0071303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLEEPVQAADTVDPCPPGIPNLKTVLSDDASNSSVLEDIDVSNTSSSSSSSSSSSSSS
GSCSGSGTDTDTGKGSSNVGSLDVTSSSSIGSETSISSTGSTAIAGPSTLLDDSNSSGLG
LVVDVDSNGSSQELSSHGVTELDSLEDSCSGLMIKDGDKLCKLCSLRLVMPRILSCLHVF
CEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKAL
PCDYIVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHH
VVRIEDLTKNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYET
ATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKR
MLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLL
KPIISAQCLNLMEQTPKCDINYQLQFDSKPEMFEQFAREMFGKFQTDHIDSSPKKLGMTQ
QLQQQQQQQQQLQQQQHQHQHQVQQQQHHHQQQQQQKQQVQHQQQQQKLQLQQQQQHQHN
SNNLIVGHRGSSSVQGRLTSAVFSPISLPSSLQSSFDGDTNSVMSNFSMMDSPPQPSSQQ
QLPSAQQQSQQQQQQQQQQQAVVLQQVQQQQKHQQHQVQQQQQQQVLHQPTSAQSMPQQL
GQLVAPQGIVQQAGHVNLNAGPGPNISINGLGAGGPPPSFSMLEYNISRLASLTETMPDT
LNDALAVGGGAAGPVPNVVAQVPGGSAVTGAAVVGASHAHQQQSQAVMPASAVTPTQPIT
LADILSGDQRALNNLQALAKLGLNNNDFCMPPATSPSLQSLNPIVGGVEDMGLNNFHAVA
APGTTSVVTGRNKATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVF
DKMGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIFSKCGHFMRKI
AIRYIDIVAGLAVTAKGHIVAVDSVSPTVFVISEEGELVRWFDCSDYMREPSDIAIRDND
FYVCDFKGHCVAVFQDDGTFLYRIGNEKVTCFPNGIDISNAGDVLIGDSHGNRFHVACYS
REGALQSEFECPHVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYVH
Download sequence
Identical sequences Q9W378
FBpp0071238 FBpp0071238 7227.FBpp0071238 FBpp0071238 FBpp0305660 FBpp0305662 NP_001259376.1.81976 NP_001259378.1.81976 NP_652022.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]