SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071476 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071476
Domain Number 1 Region: 371-431
Classification Level Classification E-value
Superfamily RING/U-box 0.0000168
Family RING finger domain, C3HC4 0.04
Further Details:      
 
Weak hits

Sequence:  FBpp0071476
Domain Number - Region: 9-66
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0251
Family Rabaptin-5 0.065
Further Details:      
 
Domain Number - Region: 149-205
Classification Level Classification E-value
Superfamily Hypothetical protein MTH393 0.0471
Family Hypothetical protein MTH393 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071476   Gene: FBgn0034573   Transcript: FBtr0071547
Sequence length 432
Comment pep:known chromosome:BDGP5:2R:16903099:16904951:-1 gene:FBgn0034573 transcript:FBtr0071547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSESLACSSVEKDLTRVVSKLEQLHENAEADIGDIATQMSELVEVLSRAEQLVTTLNSS
TQVSQDDPMGDAVSMQVETEPTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSI
SKIGKAIDRNFSADFSSTMRVDVLQDEENLMLLNKAIAKHYCRQGMDDVARTLIRECKMS
PEHAQDVFDSEREFADIYGIWVKIQKRDLTDALKWAKMYSQQLSDRHSLIEFRLHRMRFM
QLVSYGLDSQREAISYARLNFKKFAVRYEHEIANLMASFIYLPSGLENSPYKHFLGQEKW
TELSFIFLKDACQLLGISKNSALSVVVNAGCTALPALLNIKQVMQSRQVLGMWNGCDELP
IEIDLQPEFRFHSIFACPILRQQTSEDNPPKKLTCGHVISNDALHKLSVGHILKCPYCPV
EQNAEEAVRIYF
Download sequence
Identical sequences Q9W2N5
FBpp0071476 NP_611536.1.81976 FBpp0071476 7227.FBpp0071476 FBpp0071476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]