SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071950 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071950
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-31
Family Bromodomain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071950   Gene: FBgn0050417   Transcript: FBtr0072041
Sequence length 268
Comment pep:known chromosome:BDGP5:2R:19214262:19215104:-1 gene:FBgn0050417 transcript:FBtr0072041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDL
STVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLY
ICSSGSKVRAEEESSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPA
TLETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAEYCNKELEFDICKLKV
HTKRGIRDYLASKGFTGKRVARTKPKYN
Download sequence
Identical sequences Q9W1S2
7227.FBpp0071950 FBpp0071950 NP_726307.1.81976 FBpp0071950 FBpp0071950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]