SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072590 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072590
Domain Number 1 Region: 36-271
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-30
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 2 Region: 401-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000225
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0072590
Domain Number - Region: 371-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000939
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072590   Gene: FBgn0011204   Transcript: FBtr0072706
Sequence length 644
Comment pep:known chromosome:BDGP5:3L:1503226:1517238:-1 gene:FBgn0011204 transcript:FBtr0072706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRIRFGMDVLLVLLLATCLLTPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHEFDE
LSALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNESVGGLAYDPLN
MNLFWSDTEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPT
VERINLDGSNRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVV
LKDKHHEPLNLAVTNDAIYWTDRTTRAVWSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPE
PVAEDCPLVRVANLSEEARGIVARTGFYQRLQKDHHCASIVRKVKERVDEQSRKFEIRSL
LDQKIKVLEDERCMNDGEYRAATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPK
CYCQPGFKGERCELSVCSGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSL
FCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAIPQYQHLEVCLTPRVWTSSVIIILVVG
IVSSLLLVAVIVQGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTPLTNRPLATEQCEITI
ENCCNMNICETPCFDPKLVEQTLSKSSCKEDKKILIHNMEDDLY
Download sequence
Identical sequences Q95RU0
7227.FBpp0072590 NP_612113.2.81976 FBpp0072590 FBpp0072590 FBpp0072590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]