SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073256 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073256
Domain Number 1 Region: 276-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000095
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0073256
Domain Number - Region: 184-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0152
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 243-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.028
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073256   Gene: FBgn0021742   Transcript: FBtr0073400
Sequence length 559
Comment pep:known chromosome:BDGP5:X:10858240:10861165:-1 gene:FBgn0021742 transcript:FBtr0073400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDKKAALLLVTAITALKLEEMNAYRRNFDARQSSNSNIPLWKQRACEKSQKQRQNAHY
VCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSGELCDKCIPLPG
CQHGGCTKPFECICKPGWAGLFCTEPSCRTGCHSTRGYCEAPGECRCRIGYAGRTCSECA
TMPGCQHGTCNKPLECLCLPGYTGLLCQTPICDPDCSKQHGYCRKPGECRCKVGWTGSQC
DKCFPYPGCANGDCEAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGGKCTSLSREDGS
YQCQCRQGFLGKNCEIRDDFLLTSEAPPRITPPTPAELVLELDGELDQNGQQDIGAGVPD
DSEPGGGLVGEKLPAGNEPERRKNDTVANVATAGTGAGAGPMNSLPGNSNATRTTLVVAT
ETGSDNATNEALSAVTTRRATPIPLTSGEKTVKGNATSVSVATGPQPRPPLPIVASQEQT
IANLAPAGTVTVTATTAPTATTAATSVTSHKDKPNVADEEEDEDDDDDEEDEDGEYDEEE
DEDEDDEEDDSDQLIPNII
Download sequence
Identical sequences Q9VZ44
FBpp0073256 NP_572673.1.81976 FBpp0073256 FBpp0073256 7227.FBpp0073256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]