SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076186 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076186
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-43
Family Phosphotyrosine-binding domain (PTB) 0.0000144
Further Details:      
 
Domain Number 2 Region: 292-396
Classification Level Classification E-value
Superfamily SH2 domain 1.09e-24
Family SH2 domain 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076186   Gene: FBgn0015296   Transcript: FBtr0076458
Sequence length 409
Comment pep:known chromosome:BDGP5:3L:9420100:9421779:1 gene:FBgn0015296 transcript:FBtr0076458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKNGDAGNRSGSGTTSDGCIYPDDVIMGVGVAFNVRYTGCVEVKTSMKSLDFETRTQLA
RECINRVCEAAGLKSAGKRRLTNFISDRPSMQHAGTNIIINVSSRALSLSNVETGEVIAN
HNMPRISFASGGDNDTLDFLAYIAKNEDEWRACYVLECAGGQSEDLIVTIGKAFALRFNA
LSRLNDPSADCNINQSCKENVKEYYNDLPNKLPPEVPEPQQQQVQQPLHPHAPRVAQLNL
KKPRDRLSSNLIDLNSPPPDQTTNKLGHFDPLQATTAANSVLPSVRDVFDGPQCPLTAEV
WFHAGISRPISERLLQQDGDFLVRESQGKRGQYVLTGLEGKTPKHLLLIDPEGVVRTKDR
IFDSISHLINYHWAHALPIISEDSELVLRNPVRRPQQDQAASPITSASS
Download sequence
Identical sequences B4QN62 Q9V3C8
7227.FBpp0076186 FBpp0076186 FBpp0076186 FBpp0076186 NP_524683.2.81976 XP_002084260.1.80810 FBpp0212583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]