SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076580 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076580
Domain Number 1 Region: 50-130
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000197
Family Pointed domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076580   Gene: FBgn0052380   Transcript: FBtr0076870
Sequence length 600
Comment pep:known chromosome:BDGP5:3L:7367142:7374617:-1 gene:FBgn0052380 transcript:FBtr0076870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGEIGDPVTQPRSEGGGLVTMDQETRTHYLDAATDKHLTNGSPDPEPVDPLLVAQWSI
ENVTSWATCMEHFSRTLLDCLRQEAIDGEVLLSLTEEDVRDMRYKLGYKLTFGELKKFWI
AVLKLQLLVKNSSAESVILGIECHGNGNSVYMPLASTGCGPPSSSTCPCPQAECPSYVSD
CDTYLRMGGRYVPPEYFKTAMSLGYSFVVTWITSLTMVIVHERVPDMKRYPPLPDIFLDN
VPHIPWAFNMCEITGSLLFTIWVVVLTFHKYRLVLLRRFFALAGTVFLLRCVTMLITSLS
VPGTHLQCSQKDFAIDDPNVDMVGALIIRMSRAYRIWSGLGMSIQGVRTCGDYMFSGHTV
ALTLLNFFITEYTPRNLYFLHTLTWLLNMFGIFFILAAHEHYSIDVFVAFYITSRLFLYY
HTLANNRALMQSDSKRTRVWFPMFSYFESSVDGMVPNEYDTLGSLIDGIIEQIFKAKDQL
AISVKRCWLDAPLSGNSSAHMFGGESEQCLRNGTASAAFFSPHQSLIGGLGGQRSQTHLN
SAQSGSSTPTPATSAPTKSLPTQKKTFRDASVDPFSRTTFAAVQQAENVKDSPMKEKKHL
Download sequence
Identical sequences Q9VS60
FBpp0076580 FBpp0076580 7227.FBpp0076580 FBpp0076580 NP_648114.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]