SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077193 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077193
Domain Number 1 Region: 11-228
Classification Level Classification E-value
Superfamily L domain-like 7.14e-32
Family Internalin LRR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077193   Gene: FBgn0031575   Transcript: FBtr0077504
Sequence length 829
Comment pep:known chromosome:BDGP5:2L:3867714:3871425:1 gene:FBgn0031575 transcript:FBtr0077504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDESGEEKHVLNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLA
RNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNL
ECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLN
EICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKA
EWLYSQGRGRQFRVGEQQGLAKYLSSVCPLVGKALENENDRKLRLILSKAQHHQRQLQEE
IMDNANSSASTSPSSHRKKPTSRIQSPRFSRLSGRQGSPESMVNSYHGNSSNNSIVSDNG
STNHSLQMSISLIENIKNDGEGFSLAGSGMSSSVTTKTYNSTESTPRNITPNPYNGMTIK
IYSMQEWKMMLIVNNNSTDQTFISQTPSGGPLAAASKMVPVPETLMSPDVCPAAVAQRVT
VTALNPQLHKTKINKNKDNKLNLPRVRSPQLKRNQSPTSSPRRMANKCSADNMQAPEKLQ
QSAVLADSGGFSTDDDGEQINIEKLRAIRKMAAQKQQQMHQEQLKQQVDNNLNCQDRLIE
HVTESSAVTIQKMWRGYHTRKKTNKDIAERLQRRRTQEYIEQLGKDMLLTKAQLENERKI
QQLQMQAINALWKKVSTMEVDPKGIPAAAEQGEDSNGGGSGHLSLDQNSAAVVNDLAKRC
TMLTDQVQMLQSSIGTIVNCLTMVCNLPQDAIKKQAEIIDCSSTQTDLIAVHTPQIEDLT
NFPFTKTRPSTLALESKHEAALACPKIDELNDVDLKETQEDSENLDKDP
Download sequence
Identical sequences FBpp0288694 FBpp0288694 7227.FBpp0288694 FBpp0077193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]