SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077842 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0077842
Domain Number - Region: 191-330
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0103
Family MATH domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077842   Gene: FBgn0036979   Transcript: FBtr0078184
Sequence length 334
Comment pep:known chromosome:BDGP5:3L:20363413:20364846:1 gene:FBgn0036979 transcript:FBtr0078184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEEESGSGLFNVTGNPLDTEAAPKLPSEVQKAVCTVTAGEVKASAEAVTTKTLKGVCG
SDEMNMAFRSLENKLYEELRVMKLILVHLAKANGLKLNTAFSPSVTTPPPTMRPITSAAV
PPIFKPIDPPKKLSNSTNSKAEENEVAPDFGLKKTPTLKNLDSNANLGARENEVDKFNNT
VLADQDVKLFTYYWKLENVTELIKAPKLATVSSPIFSFKGKSLQLKCTFHHMNRELLNLQ
LGYGVFNPKSKTGQSNNILLEMDGIFQNTKWTEDIQLKHKISILDQSHTQRRTQDLSSQV
LNKLDTGFSIPNSVLLGSSYIKQNALLIQILLYL
Download sequence
Identical sequences Q9VPG9
FBpp0077842 7227.FBpp0077842 NP_649215.1.81976 FBpp0077842 FBpp0077842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]