SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079813 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079813
Domain Number 1 Region: 68-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.71e-29
Family Cold shock DNA-binding domain-like 0.0000375
Further Details:      
 
Domain Number 2 Region: 10-61
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000161
Family ECR1 N-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079813   Gene: FBgn0032346   Transcript: FBtr0080226
Sequence length 204
Comment pep:known chromosome:BDGP5:2L:11122564:11123792:-1 gene:FBgn0032346 transcript:FBtr0080226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQQDETVVCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVH
KPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRV
DIYKSFRPGDVILARVINQLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQC
PQTTIKEPRKVAKVLPESSINAVK
Download sequence
Identical sequences Q9VKJ4
FBpp0079813 FBpp0079813 NP_609492.1.81976 FBpp0079813 7227.FBpp0079813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]