SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080229 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080229
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000412
Family ZZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080229   Gene: FBgn0051835   Transcript: FBtr0080667
Sequence length 349
Comment pep:known chromosome:BDGP5:2L:14735843:14737067:1 gene:FBgn0051835 transcript:FBtr0080667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDL
VPLLYGEIPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAE
LVAIRHLSKHLLHNHIDHANYLEPDTPPLRRIFTRNHMRHHRQSQLQTTPNSRIFDISVW
LSTGRVSSDPQLLSNNDPPEEAANSESLALGLSSGGPFEHDDDRYVLLQWIAQQKVQCHD
TDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGESDLDQENHSSLVKVMSVMS
LPWTGVWQTNQLDGSEGEGEIRAAKKDGVDLDKVQIEEHKRVAAEEAID
Download sequence
Identical sequences Q7KT86
FBpp0080229 FBpp0290952 FBpp0080229 FBpp0290952 7227.FBpp0080229 FBpp0080229 FBpp0290952 NP_001162977.1.81976 NP_723881.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]