SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080593 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080593
Domain Number 1 Region: 463-572
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000485
Further Details:      
 
Domain Number 2 Region: 575-615
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000183
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080593   Gene: FBgn0041184   Transcript: FBtr0081040
Sequence length 720
Comment pep:known chromosome:BDGP5:2L:18138668:18152410:-1 gene:FBgn0041184 transcript:FBtr0081040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHHLSKFSARANSQEKRNPTASSSPREAAALVETISLDEEELQVEEILTEATVSAATSP
AEVRQIIIKIQLAKMENGNPVAAGQVESFAEVVEQEEEQQRQCADGATDDDAAALSADSL
NANGQIVNVTLEGGYGEVGVVTNRTAGSSPEAAKTERQPVNNNGLAGSVGAAISTLQLHD
NHGGNANCPLEADDDDDLDESLLRRRRSNSNSRSNIHHHHHHHQQQQQQQHEAEVVEYCE
VLESLPVSNMLSAGTQHSSKPVSRSNNSNSCCRSRSSKALSMGAATSSASGSASTSVSTS
TSSKRRCCKCKCRDAIRGLRDMLPSSSSSVSNKKDAAAVVAMVPRKSRTADRRSTPPTLG
TSSGGSQRRMQSQRIRNSVAVPDASHHHHQLIIRITSPGFVVESPNGGRVTVVTEPAPQS
PQTPPRPRPLATVAPAGGAGHAGIGAARNMTVHSQIDFMHCLVPDLEKITNSSFYWGKMD
RYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKFSFDCHDPCVF
TAPTVTGLLEHYKDPACVMFFEPCLTIPLHRRQTFSLQQLSRATIVSNTSYDGINQMELP
GRLKSYLKEYHYKQKLRREEQQVGFTYYEDVESGSEVDEDDDEGVNIRVSYVQHAEVVAQ
LQQVTTASGPSAPSSSRSSNLQEHLSRLPNRMAAAFGRMSANLNCYQKTVATPERHSNSS
Download sequence
Identical sequences FBpp0080594 FBpp0080593 7227.FBpp0080594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]