SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081621 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0081621
Domain Number - Region: 109-164
Classification Level Classification E-value
Superfamily ARID-like 0.0126
Family ARID domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081621   Gene: FBgn0037761   Transcript: FBtr0082143
Sequence length 265
Comment pep:known chromosome:BDGP5:3R:5638469:5639661:1 gene:FBgn0037761 transcript:FBtr0082143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLLNGTLIISEDPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRA
YNIMQIVYNGVILIAGLHFLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLL
ETVFFVLRKKDRQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYY
YLSSVSKDVQTSRWKKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFI
LMFANFYIHNYILNGSKQKSALKSD
Download sequence
Identical sequences Q9VH59
FBpp0081621 FBpp0081621 NP_649955.1.81976 FBpp0081621 7227.FBpp0081621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]