SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083680 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083680
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.25e-64
Family Penicillin synthase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083680   Gene: FBgn0053093   Transcript: FBtr0084287
Sequence length 322
Comment pep:known chromosome:BDGP5:3R:18356416:18357644:-1 gene:FBgn0053093 transcript:FBtr0084287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFD
GFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQL
PGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYP
PVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGE
TMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSD
VIQNAYDITMALAKGAFAHHYS
Download sequence
Identical sequences Q86B82
NP_788715.2.81976 FBpp0083680 FBpp0083680 FBpp0083680 7227.FBpp0083680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]