SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083989 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083989
Domain Number 1 Region: 435-850
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.09e-136
Family RNB domain-like 0.00000000282
Further Details:      
 
Domain Number 2 Region: 231-320,377-428
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.33e-40
Family Cold shock DNA-binding domain-like 0.00032
Further Details:      
 
Domain Number 3 Region: 854-941
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000188
Family Cold shock DNA-binding domain-like 0.0078
Further Details:      
 
Domain Number 4 Region: 61-209
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000000177
Family PIN domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083989   Gene: FBgn0039183   Transcript: FBtr0084605
Sequence length 982
Comment pep:known chromosome:BDGP5:3R:20159145:20162971:1 gene:FBgn0039183 transcript:FBtr0084605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTLREFTRKTKRGNILKIVREHYLRDDIGCGSELCRECFQNEVYQLTSQHANKSTLFKF
PHYLVLDTNVVLDQIDVLEEDVLRNVVVLTTVLNEVKHRSSAIYKRFNEIVHDRTRNFYV
FVNEHHKETYADREPDETANDRNDRAIRLATKWYDDHLQASQSSKEFERSGKAATRVVLL
TDDAANRAKAEAEGILVTTAAEYVKSLEDFPLLMDKLSHKTFDSEKNGLPQYPPHLSMKE
LLEGLRQNKLLQGTFQASRENYLEGTVNVEKFEKGILIQGRESLNRAVDGDLVAVELLPE
AEWSAPSEIVLEEKNVYADEVPSEERAKDENEMLNQVRAAALSAERTPTGRIVGIVRRKW
RQYCGILQPSLIEDTNRHIFVPADRKIPRIRIETRQAAMLQNQRIIVTIDTWPRNSRYPH
GHFVRSLGPLGDMATENEVILLEHDVPHCKFSDEVLSFLPKMPWTITDEDYSKRVDLRDL
YICSVDPPGCTDIDDALHCKELPNGNLEVGVHIADVSHFIRPGNALDMEAAARGTTVYLV
GKRIDMVPELLSSNLCSLVGGVERFAFSCVWEVDNEANVLSKRFHKSVIKSKRAMTYEEA
QNIIDDATQQNEIAKSLRNLNRLAKILKKRRMDNGALVLASPEIRFQVDSETHEPLEVEV
KQMRETNSMVEEFMLLANITVAEHIATEFSECAVLRRHPRPPPTNFDPLVKSARYQGFQV
DINSGLELSHSLDKCVKADNPYFNTMIRILTTRCMMQAVYFISGSLQKEEFFHYGLAAPI
YTHFTSPIRRYSDIMVHRLLAASIGADSTYAQLLDRKSNEELCHNLNYRHKMAQYAGRAS
VALNTHLFFRGKEEDEEGYVLFVRKNALQVLIPKYGLEGTLYLKSDKDGKDGVERVKSEI
VFTFNEEDHTQRCGDVVFHSFDPVTVRLSLDSSNVQHEKLIFRLVKPYIKGFSVETTTEG
TDSQAVSAAPPSKKTKKDKKKK
Download sequence
Identical sequences Q9VC93
FBpp0083989 NP_001262910.1.81976 NP_651246.2.81976 FBpp0083989 FR286 FBpp0083989 7227.FBpp0083989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]