SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084115 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084115
Domain Number 1 Region: 637-752
Classification Level Classification E-value
Superfamily Bromodomain 4.71e-31
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 507-618
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 175-294
Classification Level Classification E-value
Superfamily Bromodomain 1.28e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-24
Family Bromodomain 0.0015
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 3.79e-18
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 6 Region: 1302-1374
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000393
Family HMG-box 0.0012
Further Details:      
 
Domain Number 7 Region: 761-866
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000209
Family Bromodomain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084115   Gene: FBgn0039227   Transcript: FBtr0084740
Sequence length 1654
Comment pep:known chromosome:BDGP5:3R:20625691:20630977:-1 gene:FBgn0039227 transcript:FBtr0084740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYIPGSSEHQDAVSLWQHIHSQRQRIMEANGLAEEEPRARRMSRQVRRMTSST
EPGGDGATDDEYNQYEELFASVMTATDPVGDRLMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLAEMERDLLQMTKNACLFNEPGSQIYKDAKSLKRIFTQRRIELEMG
KGKLAKRVKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKK
AFPTSHRTHKDALKMLKLMNAKLVEESLEEGSDLDDEDAEEMDTEVFTVSTQPEKRKPGR
PRINSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEK
PPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANILERALNEKLKEFPGLTEGKKSQQKYSKVGRKLKTAVITERLWQFYETVKEYQEPKG
KRQLSLIFTKLPSKSEYPDYYDIIREPIDMDRIAQKLKQGAYDTLDDLAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTIYNHQDEEG
RCYSDSLAELPEYDEIGEGPKVRGISLDLVKRRLDKGAYKRLDVYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDELCKDTLSSSALNFSLERLMADVELCRQQKMQQEEQDQ
EQDKEKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSICCIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVQGMCYVMNIKDYIKMRPENLPEKD
VYVCESRYNIQGRWFKKLKSWPPVREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELE
ELKLQETLVEKEKPNVSCDPPPNAEVGSTYYQQYNTICSGAIKTGDFVYVATQTGKQSVA
QVQQIWEQNGKSYFKGPWLLPPSETTPGLGKQFYRQELLLSTVEEVSPVVGIVGRCAVLE
YSEFISSRPTEISESDVYICESVYDELKKALRKLVTGNMRKFQHSPSVTEDEIFYFKTPI
KPSKDFKNELNELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAAKSAKKCL
TGYILYSSEVRKSICQSNPDATFGDISRMVGTEWKNLPSSVKQSWEDRASRQNEETAALR
RELDDVQNSASPSSQVSQDVFGQVLTFECQWDKCDFQFEELSDCTEHCMSDSTGHIQRHP
QAGVETEYVCLWRNCPRVKKSVQAFPNVLRLIKHVREVHLSKCGKTISAADRSKNFVPRR
QKHAQLATTVPIPPSLAQSPRAPSNLEAVQLQQQQHPQQNMHQLQQQQTIVLGPPPEPLF
VTVPPRTTRVIHSEAYIKYIESLQTGSHLNVVTCNNNWRRALTHITPAQVVAKTALPEKW
IGPNLRDQGNVVQALCHLRNFMVDDILQIRRSCN
Download sequence
Identical sequences Q9VC36
NP_651288.1.81976 7227.FBpp0084115 FBpp0084115 FBpp0084115 FBpp0084115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]